DCUN1D5 (NM_032299) Human Mass Spec Standard

SKU
PH300870
DCUN1D5 MS Standard C13 and N15-labeled recombinant protein (NP_115675)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200870]
Predicted MW 27.5 kDa
Protein Sequence
Protein Sequence
>RC200870 protein sequence
Red=Cloning site Green=Tags(s)

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
LSNYDEDGAWPVLLDEFVEWQKVRQTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115675
RefSeq Size 12732
RefSeq ORF 711
Synonyms SCCRO5
Locus ID 84259
UniProt ID Q9BTE7
Cytogenetics 11q22.3
Summary Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:DCUN1D5 (NM_032299) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410241 DCUN1D5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410241 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) 100 ug
$436.00
TP300870 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.