OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

DCUN1D5 (NM_032299) Human Mass Spec Standard

Be the first to review this product
SKU
PH300870
DCUN1D5 MS Standard C13 and N15-labeled recombinant protein (NP_115675)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (1)

LY410241 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) (as WB positive control) 100 ug
$436.00

Other products for "DCUN1D5 or NM_032299"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200870
Predicted MW 27.5 kDa
Protein Sequence
Protein Sequence
>RC200870 protein sequence
Red=Cloning site Green=Tags(s)

MPVKKKRKSPGVAAAVAEDGGLKKCKISSYCRSQPPARLISGEEHFSSKKCLAWFYEYAGPDEVVGPEGM
EKFCEDIGVEPENIIMLVLAWKLEAESMGFFTKEEWLKGMTSLQCDCTEKLQNKFDFLRSQLNDISSFKN
IYRYAFDFARDKDQRSLDIDTAKSMLALLLGRTWPLFSVFYQYLEQSKYRVMNKDQWYNVLEFSRTVHAD
LSNYDEDGAWPVLLDEFVEWQKVRQTS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_115675
RefSeq Size 12732
RefSeq ORF 711
Synonyms SCCRO5
Locus ID 84259
UniProt ID Q9BTE7
Cytogenetics 11q22.3
Summary Contributes to the neddylation of all cullins by transfering NEDD8 from N-terminally acetylated NEDD8-conjugating E2s enzyme to different cullin C-terminal domain-RBX complexes which is necessary for the activation of cullin-RING E3 ubiquitin ligases (CRLs) (PubMed:26906416, PubMed:23201271, PubMed:19617556). May play a role in DNA damage response and may participate to cell proliferation and anchorage-independent cell growth (PubMed:23098533, PubMed:24192928).UniProtKB/Swiss-Prot Function
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "DCUN1D5" proteins (3)
SKU Description Size Price
LC410241 Lyophilized DCUN1D5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY410241 Transient overexpression lysate of DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5) (as WB positive control) 100 ug
$436.00
TP300870 Recombinant protein of human DCN1, defective in cullin neddylation 1, domain containing 5 (S. cerevisiae) (DCUN1D5), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products