RMND5B (NM_022762) Human Mass Spec Standard

SKU
PH300863
RMND5B MS Standard C13 and N15-labeled recombinant protein (NP_073599)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200863]
Predicted MW 44.4 kDa
Protein Sequence
Protein Sequence
>RC200863 protein sequence
Red=Cloning site Green=Tags(s)

MEQCACVERELDKVLQKFLTYGQHCERSLEELLHYVGQLRAELASAALQGTPLSATLSLVMSQCCRKIKD
TVQKLASDHKDIHSSVSRVGKAIDRNFDSEICGVVSDAVWDAREQQQQILQMAIVEHLYQQGMLSVAEEL
CQESTLNVDLDFKQPFLELNRILEALHEQDLGPALEWAVSHRQRLLELNSSLEFKLHRLHFIRLLAGGPA
KQLEALSYARHFQPFARLHQREIQVMMGSLVYLRLGLEKSPYCHLLDSSHWAEICETFTRDACSLLGLSV
ESPLSVSFASGCVALPVLMNIKAVIEQRQCTGVWNHKDELPIEIELGMKCWYHSVFACPILRQQTSDSNP
PIKLICGHVISRDALNKLINGGKLKCPYCPMEQNPADGKRIIF

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_073599
RefSeq Size 1984
RefSeq ORF 1179
Synonyms GID2; GID2B
Locus ID 64777
UniProt ID Q96G75
Cytogenetics 5q35.3
Summary Core component of the CTLH E3 ubiquitin-protein ligase complex that selectively accepts ubiquitin from UBE2H and mediates ubiquitination and subsequent proteasomal degradation of the transcription factor HBP1. MAEA and RMND5A are both required for catalytic activity of the CTLH E3 ubiquitin-protein ligase complex (PubMed:29911972). Catalytic activity of the complex is required for normal cell proliferation (PubMed:29911972). The CTLH E3 ubiquitin-protein ligase complex is not required for the degradation of enzymes involved in gluconeogenesis, such as FBP1 (PubMed:29911972).[UniProtKB/Swiss-Prot Function]
Protein Families Stem cell - Pluripotency
Write Your Own Review
You're reviewing:RMND5B (NM_022762) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411580 RMND5B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411580 Transient overexpression lysate of required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B) 100 ug
$436.00
TP300863 Recombinant protein of human required for meiotic nuclear division 5 homolog B (S. cerevisiae) (RMND5B), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.