CDCA3 (NM_031299) Human Mass Spec Standard

SKU
PH300821
CDCA3 MS Standard C13 and N15-labeled recombinant protein (NP_112589)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200821]
Predicted MW 29 kDa
Protein Sequence
Protein Sequence
>RC200821 protein sequence
Red=Cloning site Green=Tags(s)

MGSAKSVPVTPARPPPHNKHLARVADPRSPSAGILRTPIQVESSPQPGLPAGEQLEGLKHAQDSDPRSPT
LGIARTPMKTSSGDPPSPLVKQLSEVFETEDSKSNLPPEPVLPPEAPLSSELDLPLGTQLSVEEQMPPWN
QTEFPSKQVFSKEEARQPTETPVASQSSDKPSRDPETPRSSGSMRNRWKPNSSKVLGRSPLTILQDDNSP
GTLTLRQGKRPSPLSENVSELKEGAILGTGRLLKTGGRAWEQGQDHDKENQHFPLVES

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_112589
RefSeq Size 1944
RefSeq ORF 804
Synonyms GRCC8; TOME-1
Locus ID 83461
UniProt ID Q99618
Cytogenetics 12p13.31
Summary F-box-like protein which is required for entry into mitosis. Acts by participating in E3 ligase complexes that mediate the ubiquitination and degradation of WEE1 kinase at G2/M phase (By similarity).[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:CDCA3 (NM_031299) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC410572 CDCA3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY410572 Transient overexpression lysate of cell division cycle associated 3 (CDCA3) 100 ug
$436.00
TP300821 Recombinant protein of human cell division cycle associated 3 (CDCA3), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.