C11orf48 (LBHD1) (NM_024099) Human Mass Spec Standard

SKU
PH300782
C11orf48 MS Standard C13 and N15-labeled recombinant protein (NP_077004)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200782]
Predicted MW 28.8 kDa
Protein Sequence
Protein Sequence
>RC200782 protein sequence
Red=Cloning site Green=Tags(s)

MALVPGRSKEDGLWTRNSPGSSQHPESPRLPNPLWDRGKIGKVEGHQHIQDFSQKSHLPSIVVESSEVNE
ESGDLHLPHEELLLLTDGEEEDAEAFFQDQSEEPGWAWSPQDPRSPLRTFNAGLSWGQDQDEEDACWILE
DTACLEATNHCPFWDSTGSRVCRSGFVEYSHLLPPNSFEGAEEEAVQTPAGVESGAASEAPGGRGCDRPR
ADHAAPPQEAGVQCTCQHYTVREEAQKTPPADPACPEREDSHGSGSPFKASQD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077004
RefSeq Size 1357
RefSeq ORF 789
Synonyms C11orf48
Locus ID 79081
UniProt ID Q9BQE6
Cytogenetics 11q12.3
Summary This gene shares three exons in common with another gene, chromosome 11 open reading frame 98 (GeneID:102288414), but the encoded protein uses a reading frame that is different from that of the chromosome 11 open reading frame 98 gene. [provided by RefSeq, Nov 2017]
Write Your Own Review
You're reviewing:C11orf48 (LBHD1) (NM_024099) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC411370 LBHD1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY411370 Transient overexpression lysate of chromosome 11 open reading frame 48 (C11orf48) 100 ug
$436.00
TP300782 Recombinant protein of human chromosome 11 open reading frame 48 (C11orf48), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.