DDX19B (NM_007242) Human Mass Spec Standard

SKU
PH300760
DDX19B MS Standard C13 and N15-labeled recombinant protein (NP_009173)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200760]
Predicted MW 53.9 kDa
Protein Sequence
Protein Sequence
>RC200760 protein sequence
Red=Cloning site Green=Tags(s)

MATDSWALAVDEQEAAAESLSNLHLKEEKIKPDTNGAVVKTNANAEKTDEEEKEDRAAQSLLNKLIRSNL
VDNTNQVEVLQRDPNSPLYSVKSFEELRLKPQLLQGVYAMGFNRPSKIQENALPLMLAEPPQNLIAQSQS
GTGKTAAFVLAMLSQVEPANKYPQCLCLSPTYELALQTGKVIEQMGKFYPELKLAYAVRGNKLERGQKIS
EQIVIGTPGTVLDWCSKLKFIDPKKIKVFVLDEADVMIATQGHQDQSIRIQRMLPRNCQMLLFSATFEDS
VWKFAQKVVPDPNVIKLKREEETLDTIKQYYVLCSSRDEKFQALCNLYGAITIAQAMIFCHTRKTASWLA
AELSKEGHQVALLSGEMMVEQRAAVIERFREGKEKVLVTTNVCARGIDVEQVSVVINFDLPVDKDGNPDN
ETYLHRIGRTGRFGKRGLAVNMVDSKHSMNILNRIQEHFNKKIERLDTDDLDEIEKIAN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009173
RefSeq Size 1829
RefSeq ORF 1437
Synonyms DBP5; DDX19; RNAh
Locus ID 11269
UniProt ID Q9UMR2
Cytogenetics 16q22.1
Summary DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases. They are implicated in a number of cellular processes involving alteration of RNA secondary structure such as translation initiation, nuclear and mitochondrial splicing, and ribosome and spliceosome assembly. Based on their distribution patterns, some members of this family are believed to be involved in embryogenesis, spermatogenesis, and cellular growth and division. This gene encodes a DEAD box protein, which exhibits RNA-dependent ATPase and ATP-dependent RNA-unwinding activities. This protein is recruited to the cytoplasmic fibrils of the nuclear pore complex, where it participates in the export of mRNA from the nucleus. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:DDX19B (NM_007242) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416102 DDX19B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423072 DDX19B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC423074 DDX19B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416102 Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 1 100 ug
$436.00
LY423072 Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 3 100 ug
$436.00
LY423074 Transient overexpression lysate of DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 2 100 ug
$665.00
TP300760 Recombinant protein of human DEAD (Asp-Glu-Ala-As) box polypeptide 19B (DDX19B), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.