OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NME2 (NM_001018139) Human Mass Spec Standard

Be the first to review this product
SKU
PH300680
NME2 MS Standard C13 and N15-labeled recombinant protein (NP_001018149)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA505574 NME2 mouse monoclonal antibody, clone OTI2F9 (formerly 2F9) 100 ul
$447.00
LY419276 Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NME2 or NM_001018139"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200680
Predicted MW 17.3 kDa
Protein Sequence
Protein Sequence
>RC200680 protein sequence
Red=Cloning site Green=Tags(s)

MANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNS
GPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELV
DYKSCAHDWVYE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001018149
RefSeq Size 682
RefSeq ORF 456
Synonyms NDKB; NDPK-B; NDPKB; NM23-H2; NM23B; PUF
Locus ID 4831
UniProt ID P22392
Cytogenetics 17q21.33
Summary Nucleoside diphosphate kinase (NDK) exists as a hexamer composed of 'A' (encoded by NME1) and 'B' (encoded by this gene) isoforms. Multiple alternatively spliced transcript variants have been found for this gene. Read-through transcription from the neighboring upstream gene (NME1) generates naturally-occurring transcripts (NME1-NME2) that encode a fusion protein comprised of sequence sharing identity with each individual gene product. provided by RefSeq, Nov 2010
Protein Families Druggable Genome, Transcription Factors
Protein Pathways Metabolic pathways, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NME2" proteins (11)
SKU Description Size Price
LC419276 Lyophilized NME2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422664 Lyophilized NME2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422665 Lyophilized NME2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC422666 Lyophilized NME2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY419276 Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY422664 Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 2 (as WB positive control) 100 ug
$436.00
LY422665 Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 3 (as WB positive control) 100 ug
$436.00
LY422666 Transient overexpression lysate of non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4 (as WB positive control) 100 ug
$436.00
TP300680 Recombinant protein of human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 4, 20 µg 20 ug
$867.00
TP760412 Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, with N-terminal HIS tag, expressed in E.Coli, 50ug 50 ug
$270.00
TP761637 Purified recombinant protein of Human non-metastatic cells 2, protein (NM23B) expressed in (NME2), transcript variant 1, full length, with N-terminal GST and C-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$270.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products