PPP2R4 (PTPA) (NM_178000) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200671] |
Predicted MW | 36.8 kDa |
Protein Sequence |
Protein Sequence
>RC200671 protein sequence
Red=Cloning site Green=Tags(s) MAEGERQPPPDSSEEAPPATQNFIIPKKEIHTVPDMGKWKRSQAYADYIGFILTLNEGVKGKKLTFEYRV SEAIEKLVALLNTLDRWIDETPPVDQPSRFGNKAYRTWYAKLDEEAENLVATVVPTHLAAAVPEVAVYLK ESVGNSTRIDYGTGHEAAFAAFLCCLCKIGVLRVDDQIAIVFKVFNRYLEVMRKLQKTYRMEPAGSQGVW GLDDFQFLPFIWGSSQLIDHPYLEPRHFVDEKAVNENHKDYMFLECILFITEMKTGPFAEHSNQLWNISA VPSWSKVNQGLIRMYKAECLEKFPVIQHFKFGSLLPIHPVTSG myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_821067 |
RefSeq Size | 2764 |
RefSeq ORF | 969 |
Synonyms | PP2A; PPP2R4; PR53 |
Locus ID | 5524 |
UniProt ID | Q15257 |
Cytogenetics | 9q34.11 |
Summary | Protein phosphatase 2A is one of the four major Ser/Thr phosphatases and is implicated in the negative control of cell growth and division. Protein phosphatase 2A holoenzymes are heterotrimeric proteins composed of a structural subunit A, a catalytic subunit C, and a regulatory subunit B. The regulatory subunit is encoded by a diverse set of genes that have been grouped into the B/PR55, B'/PR61, and B''/PR72 families. These different regulatory subunits confer distinct enzymatic specificities and intracellular localizations to the holozenzyme. The product of this gene belongs to the B' family. This gene encodes a specific phosphotyrosyl phosphatase activator of the dimeric form of protein phosphatase 2A. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Phosphatase |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH312144 | PPP2R4 MS Standard C13 and N15-labeled recombinant protein (NP_066954) | 10 ug |
$3,255.00
|
|
LC406041 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406042 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC406043 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC412071 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC429647 | PPP2R4 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY406041 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2 | 100 ug |
$436.00
|
|
LY406042 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 1 | 100 ug |
$436.00
|
|
LY406043 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 5 | 100 ug |
$436.00
|
|
LY412071 | Transient overexpression lysate of protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3 | 100 ug |
$436.00
|
|
TP300671 | Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 2, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP312144 | Recombinant protein of human protein phosphatase 2A activator, regulatory subunit 4 (PPP2R4), transcript variant 3, 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.