SERPINB9 (NM_004155) Human Mass Spec Standard

SKU
PH300645
SERPINB9 MS Standard C13 and N15-labeled recombinant protein (NP_004146)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200645]
Predicted MW 42.4 kDa
Protein Sequence
Protein Sequence
>RC200645 protein sequence
Red=Cloning site Green=Tags(s)

METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAF
QSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKT
EGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVG
EVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWTKPDCMKSTEVEVLLPKFKLQEDYDM
ESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFC
ADHPFLFFIRHNRANSILFCGRFSSP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004146
RefSeq Size 4167
RefSeq ORF 1128
Synonyms CAP-3; CAP3; PI-9; PI9
Locus ID 5272
UniProt ID P50453
Cytogenetics 6p25.2
Summary This gene encodes a member of the serine protease inhibitor family which are also known as serpins. The encoded protein belongs to a subfamily of intracellular serpins. This protein inhibits the activity of the effector molecule granzyme B. Overexpression of this protein may prevent cytotoxic T-lymphocytes from eliminating certain tumor cells. A pseudogene of this gene is found on chromosome 6. [provided by RefSeq, Mar 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:SERPINB9 (NM_004155) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418182 SERPINB9 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418182 Transient overexpression lysate of serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9) 100 ug
$436.00
TP300645 Recombinant protein of human serpin peptidase inhibitor, clade B (ovalbumin), member 9 (SERPINB9), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.