PSMG1 (NM_003720) Human Mass Spec Standard

SKU
PH300550
PSMG1 MS Standard C13 and N15-labeled recombinant protein (NP_003711)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200550]
Predicted MW 32.9 kDa
Protein Sequence
Protein Sequence
>RC200550 protein sequence
Red=Cloning site Green=Tags(s)

MAATFFGEVVKAPCRAGTEDEEEEEEGRRETPEDREVRLQLARKREVRLLRRQTKTSLEVSLLEKYPCSK
FIIAIGNNAVAFLSSFVMNSGVWEEVGCAKLWNEWCRTTDTTHLSSTEAFCVFYHLKSNPSVFLCQCSCY
VAEDQQYQWLEKVFGSCPRKNMQITILTCRHVTDYKTSESTGSLPSPFLRALKTQNFKDSACCPLLEQPN
IVHDLPAAVLSYCQVWKIPAILYLCYTDVMKLDLITVEAFKPILSTRSLKGLVKNIPQSTEILKKLMTTN
EIQSNIYT

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003711
RefSeq Size 1140
RefSeq ORF 864
Synonyms C21LRP; DSCR2; LRPC21; PAC-1; PAC1
Locus ID 8624
UniProt ID O95456
Cytogenetics 21q22.2
Summary Chaperone protein which promotes assembly of the 20S proteasome as part of a heterodimer with PSMG2. The PSMG1-PSMG2 heterodimer binds to the PSMA5 and PSMA7 proteasome subunits, promotes assembly of the proteasome alpha subunits into the heteroheptameric alpha ring and prevents alpha ring dimerization.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:PSMG1 (NM_003720) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401225 PSMG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404289 PSMG1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401225 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1 100 ug
$436.00
LY404289 Transient overexpression lysate of proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 2 100 ug
$436.00
TP300550 Recombinant protein of human proteasome (prosome, macropain) assembly chaperone 1 (PSMG1), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.