NDUFA7 (NM_005001) Human Mass Spec Standard

SKU PH300534

NDUFA7 MS Standard C13 and N15-labeled recombinant protein (NP_004992)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200534]
• Predicted MW: 12.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC200534 protein sequence; Red=Cloning site Green=Tags(s); ; MASATRLIQRLRNWASGHDLQGKLQLRYQEISKRTQPPPKLPVGPSHKLSNNYYCTRDGRRESVPPSIIM; SSQKALVSGKPAESSAVAATEKKAVTPAPPIKRWELSSDQPYL; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_004992
• RefSeq Size: 585
• RefSeq ORF: 339
• Synonyms: B14.5a; CI-B14.5a
• Locus ID: 4701
• UniProt ID: O95182
• Cytogenetics: 19p13.2
• Summary: This gene encodes a subunit of NADH:ubiquinone oxidoreductase (complex I), which is a multiprotein complex located in the inner mitochondrial membrane. Complex I functions in the transfer of electrons from NADH to the respiratory chain. [provided by RefSeq, Mar 2011]
• Protein Pathways: Alzheimer's disease, Huntington's disease, Metabolic pathways, Oxidative phosphorylation, Parkinson's disease