UROD (NM_000374) Human Mass Spec Standard

SKU
PH300529
UROD MS Standard C13 and N15-labeled recombinant protein (NP_000365)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200529]
Predicted MW 40.8 kDa
Protein Sequence
Protein Sequence
>RC200529 protein sequence
Red=Cloning site Green=Tags(s)

MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL
QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL
TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG
AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV
GLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV
GAFVDAVHKHSRLLRQN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000365
RefSeq Size 1408
RefSeq ORF 1101
Synonyms PCT; UPD
Locus ID 7389
UniProt ID P06132
Cytogenetics 1p34.1
Summary This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.[provided by RefSeq, Aug 2010]
Protein Families Druggable Genome
Protein Pathways Porphyrin and chlorophyll metabolism
Write Your Own Review
You're reviewing:UROD (NM_000374) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424758 UROD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424758 Transient overexpression lysate of uroporphyrinogen decarboxylase (UROD) 100 ug
$436.00
TP300529 Recombinant protein of human uroporphyrinogen decarboxylase (UROD), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720245 Recombinant protein of human uroporphyrinogen decarboxylase (UROD) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.