UROD (NM_000374) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200529] |
Predicted MW | 40.8 kDa |
Protein Sequence |
Protein Sequence
>RC200529 protein sequence
Red=Cloning site Green=Tags(s) MEANGLGPQGFPELKNDTFLRAAWGEETDYTPVWCMRQAGRYLPEFRETRAAQDFFSTCRSPEACCELTL QPLRRFPLDAAIIFSDILVVPQALGMEVTMVPGKGPSFPEPLREEQDLERLRDPEVVASELGYVFQAITL TRQRLAGRVPLIGFAGAPWTLMTYMVEGGGSSTMAQAKRWLYQRPQASHQLLRILTDALVPYLVGQVVAG AQALQLFESHAGHLGPQLFNKFALPYIRDVAKQVKARLREAGLAPVPMIIFAKDGHFALEELAQAGYEVV GLDWTVAPKKARECVGKTVTLQVNLDPCALYASEEEIGQLVKQMLDDFGPHRYIANLGHGLYPDMDPEHV GAFVDAVHKHSRLLRQN myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_000365 |
RefSeq Size | 1408 |
RefSeq ORF | 1101 |
Synonyms | PCT; UPD |
Locus ID | 7389 |
UniProt ID | P06132 |
Cytogenetics | 1p34.1 |
Summary | This gene encodes an enzyme in the heme biosynthetic pathway. This enzyme is responsible for catalyzing the conversion of uroporphyrinogen to coproporphyrinogen through the removal of four carboxymethyl side chains. Mutations and deficiency in this enzyme are known to cause familial porphyria cutanea tarda and hepatoerythropoetic porphyria.[provided by RefSeq, Aug 2010] |
Protein Families | Druggable Genome |
Protein Pathways | Porphyrin and chlorophyll metabolism |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC424758 | UROD HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY424758 | Transient overexpression lysate of uroporphyrinogen decarboxylase (UROD) | 100 ug |
$436.00
|
|
TP300529 | Recombinant protein of human uroporphyrinogen decarboxylase (UROD), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720245 | Recombinant protein of human uroporphyrinogen decarboxylase (UROD) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.