P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Mass Spec Standard

SKU
PH300525
RPS6KB2 MS Standard C13 and N15-labeled recombinant protein (NP_003943)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200525]
Predicted MW 53.5 kDa
Protein Sequence
Protein Sequence
>RC200525 protein sequence
Red=Cloning site Green=Tags(s)

MAAVFDLDLETEEGSEGEGEPELSPADACPLAELRAAGLEPVGHYEEVELTETSVNVGPERIGPHCFELL
RVLGKGGYGKVFQVRKVQGTNLGKIYAMKVLRKAKIVRNAKDTAHTRAERNILESVKHPFIVELAYAFQT
GGKLYLILECLSGGELFTHLEREGIFLEDTACFYLAEITLALGHLHSQGIIYRDLKPENIMLSSQGHIKL
TDFGLCKESIHEGAVTHTFCGTIEYMAPEILVRSGHNRAVDWWSLGALMYDMLTGSPPFTAENRKKTMDK
IIRGKLALPPYLTPDARDLVKKFLKRNPSQRIGGGPGDAADVQRHPFFRHMNWDDLLAWRVDPPFRPCLQ
SEEDVSQFDTRFTRQTPVDSPDDTALSESANQAFLGFTYVAPSVLDSIKEGFSFQPKLRSPRRLNSSPRV
PVSPLKFSPFEGFRPSPSLPEPTELPLPPLLPPPPPSTTAPLPIRPPSGTKKSKRGRGRPGR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003943
RefSeq Size 1782
RefSeq ORF 1446
Synonyms KLS; p70(S6K)-beta; P70-beta; P70-beta-1; P70-beta-2; p70S6Kb; S6K-beta2; S6K2; S6KB; S6Kbeta; S6KI(2); SRK; STK14B
Locus ID 6199
UniProt ID Q9UBS0
Cytogenetics 11q13.2
Summary This gene encodes a member of the RSK (ribosomal S6 kinase) family of serine/threonine kinases. This kinase contains a kinase catalytic domain and phosphorylates the S6 ribosomal protein and eukaryotic translation initiation factor 4B (eIF4B). Phosphorylation of S6 leads to an increase in protein synthesis and cell proliferation. [provided by RefSeq, Jan 2015]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Acute myeloid leukemia, ErbB signaling pathway, Fc gamma R-mediated phagocytosis, Insulin signaling pathway, mTOR signaling pathway, TGF-beta signaling pathway
Write Your Own Review
You're reviewing:P70 S6 Kinase beta (RPS6KB2) (NM_003952) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC401298 RPS6KB2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY401298 Transient overexpression lysate of ribosomal protein S6 kinase, 70kDa, polypeptide 2 (RPS6KB2) 100 ug
$436.00
TP300525 Recombinant protein of human ribosomal protein S6 kinase, 70kDa, polypeptide 2 (RPS6KB2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.