CKS2 (NM_001827) Human Mass Spec Standard

SKU PH300491

CKS2 MS Standard C13 and N15-labeled recombinant protein (NP_001818)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200491]
• Predicted MW: 9.9 kDa
• Protein Sequence:
  Protein Sequence

  >RC200491 protein sequence; Red=Cloning site Green=Tags(s); ; MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIHEPEPHILLFR; RPLPKDQQK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_001818
• RefSeq Size: 627
• RefSeq ORF: 237
• Synonyms: CKSHS2
• Locus ID: 1164
• UniProt ID: P33552
• Cytogenetics: 9q22.2
• Summary: CKS2 protein binds to the catalytic subunit of the cyclin dependent kinases and is essential for their biological function. The CKS2 mRNA is found to be expressed in different patterns through the cell cycle in HeLa cells, which reflects specialized role for the encoded protein. [provided by RefSeq, Jul 2008]
• Protein Families: Druggable Genome, Stem cell - Pluripotency