Claudin 4 (CLDN4) (NM_001305) Human Mass Spec Standard

SKU
PH300490
CLDN4 MS Standard C13 and N15-labeled recombinant protein (NP_001296)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200490]
Predicted MW 22.1 kDa
Protein Sequence
Protein Sequence
>RC200490 protein sequence
Red=Cloning site Green=Tags(s)

MASMGLQVMGIALAVLGWLAVMLCCALPMWRVTAFIGSNIVTSQTIWEGLWMNCVVQSTGQMQCKVYDSL
LALPQDLQAARALVIISIIVAALGVLLSVVGGKCTNCLEDESAKAKTMIVAGVVFLLAGLMVIVPVSWTA
HNIIQDFYNPLVASGQKREMGASLYVGWAASGLLLLGGGLLCCNCPPRTDKPYSAKYSAARSAAASNYV

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001296
RefSeq Size 1859
RefSeq ORF 627
Synonyms CPE-R; CPER; CPETR; CPETR1; hCPE-R; WBSCR8
Locus ID 1364
UniProt ID O14493
Cytogenetics 7q11.23
Summary The protein encoded by this intronless gene belongs to the claudin family. Claudins are integral membrane proteins that are components of the epithelial cell tight junctions, which regulate movement of solutes and ions through the paracellular space. This protein is a high-affinity receptor for Clostridium perfringens enterotoxin (CPE) and may play a role in internal organ development and function during pre- and postnatal life. This gene is deleted in Williams-Beuren syndrome, a neurodevelopmental disorder affecting multiple systems. [provided by RefSeq, Sep 2013]
Protein Families Druggable Genome, Transmembrane
Protein Pathways Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Tight junction
Write Your Own Review
You're reviewing:Claudin 4 (CLDN4) (NM_001305) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400521 CLDN4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400521 Transient overexpression lysate of claudin 4 (CLDN4) 100 ug
$436.00
TP300490 Recombinant protein of human claudin 4 (CLDN4), 20 µg 20 ug
$867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.