GALK1 (NM_000154) Human Mass Spec Standard

SKU
PH300476
GALK1 MS Standard C13 and N15-labeled recombinant protein (NP_000145)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200476]
Predicted MW 42.3 kDa
Protein Sequence
Protein Sequence
>RC200476 protein sequence
Red=Cloning site Green=Tags(s)

MAALRQPQVAELLAEARRAFREEFGAEPELAVSAPGRVNLIGEHTDYNQGLVLPMALELMTVLVGSPRKD
GLVSLLTTSEGADEPQRLQFPLPTAQRSLEPGTPRWANYVKGVIQYYPAAPLPGFSAVVVSSVPLGGGLS
SSASLEVATYTFLQQLCPDSGTIAARAQVCQQAEHSFAGMPCGIMDQFISLMGQKGHALLIDCRSLETSL
VPLSDPKLAVLITNSNVRHSLASSEYPVRRRQCEEVARALGKESLREVQLEELEAARDLVSKEGFRRARH
VVGEIRRTAQAAAALRRGDYRAFGRLMVESHRSLRDDYEVSCPELDQLVEAALAVPGVYGSRMTGGGFGG
CTVTLLEASAAPHAMRHIQEHYGGTATFYLSQAADGAKVLCL

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_000145
RefSeq Size 1361
RefSeq ORF 1176
Synonyms GALK; GK1; HEL-S-19
Locus ID 2584
UniProt ID P51570
Cytogenetics 17q25.1
Summary Galactokinase is a major enzyme for the metabolism of galactose and its deficiency causes congenital cataracts during infancy and presenile cataracts in the adult population. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Protein Pathways Amino sugar and nucleotide sugar metabolism, Galactose metabolism, Metabolic pathways
Write Your Own Review
You're reviewing:GALK1 (NM_000154) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC424894 GALK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY424894 Transient overexpression lysate of galactokinase 1 (GALK1) 100 ug
$436.00
TP300476 Recombinant protein of human galactokinase 1 (GALK1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720538 Recombinant protein of human galactokinase 1 (GALK1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.