GSK3 beta (GSK3B) (NM_002093) Human Mass Spec Standard

SKU
PH300468
GSK3B MS Standard C13 and N15-labeled recombinant protein (NP_002084)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200468]
Predicted MW 47.9 kDa
Protein Sequence
Protein Sequence
>RC200468 representing NM_002093
Red=Cloning site Green=Tags(s)

MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTKVIGNGSFGVV
YQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSGEKKDEVYLNLVLDYVPETVY
RVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRG
EPNVSYICSRYYRAPELIFGATDYTSSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQ
IREMNPNYTEFKFPQIKAHPWTKDSSGTGHFTSGVRVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAH
SFFDELRDPNVKLPNGRDTPALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQ
TNNAASASASNST

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002084
RefSeq Size 1639
RefSeq ORF 1299
Locus ID 2932
UniProt ID P49841
Cytogenetics 3q13.33
Summary The protein encoded by this gene is a serine-threonine kinase belonging to the glycogen synthase kinase subfamily. It is a negative regulator of glucose homeostasis and is involved in energy metabolism, inflammation, ER-stress, mitochondrial dysfunction, and apoptotic pathways. Defects in this gene have been associated with Parkinson disease and Alzheimer disease. [provided by RefSeq, Aug 2017]
Protein Families Druggable Genome, Protein Kinase
Protein Pathways Alzheimer's disease, Axon guidance, B cell receptor signaling pathway, Basal cell carcinoma, Cell cycle, Chemokine signaling pathway, Colorectal cancer, Endometrial cancer, ErbB signaling pathway, Focal adhesion, Hedgehog signaling pathway, Insulin signaling pathway, Melanogenesis, Neurotrophin signaling pathway, Pathways in cancer, Prostate cancer, T cell receptor signaling pathway, Wnt signaling pathway
Write Your Own Review
You're reviewing:GSK3 beta (GSK3B) (NM_002093) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419542 GSK3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC431916 GSK3B HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419542 Transient overexpression lysate of glycogen synthase kinase 3 beta (GSK3B), transcript variant 1 100 ug
$436.00
LY431916 Transient overexpression lysate of glycogen synthase kinase 3 beta (GSK3B), transcript variant 2 100 ug
$436.00
TP300468 Recombinant protein of human glycogen synthase kinase 3 beta (GSK3B), 20 µg 20 ug
$867.00
TP710339 Purified recombinant protein of Human glycogen synthase kinase 3 beta (GSK3B), transcript variant 1, full length, with C-terminal DDK tag, expressed in sf9, 20ug 20 ug
$515.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.