PRMT2 (NM_206962) Human Mass Spec Standard

SKU
PH300461
PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_996845)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200461]
Predicted MW 49 kDa
Protein Sequence
Protein Sequence
>RC200461 protein sequence
Red=Cloning site Green=Tags(s)

MATSGDCPRSESQGEEPAECSEAGLLQEGVQPEEFVAIADYAATDETQLSFLRGEKILILRQTTADWWWG
ERAGCCGYIPANHVGKHVDEYDPEDTWQDEEYFGSYGTLKLHLEMLADQPRTTKYHSVILQNKESLTDKV
ILDVGCGTGIISLFCAHYARPRAVYAVEASEMAQHTGQLVLQNGFADIITVYQQKVEDVVLPEKVDVLVS
EWMGTCLLFEFMIESILYARDAWLKEDGVIWPTMAALHLVPCSADKDYRSKVLFWDNAYEFNLSALKSLA
VKEFFSKPKYNHILKPEDCLSEPCTILQLDMRTVQISDLETLRGELRFDIRKAGTLHGFTAWFSVHFQSL
QEGQPPQVLSTGPFHPTTHWKQTLFMMDDPVPVHTGDVVTGSVVLQRNPVWIRHMSVALSWAVTSRQDPT
SQKVGEKVFPIWR

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_996845
RefSeq Size 2446
RefSeq ORF 1299
Synonyms HRMT1L1
Locus ID 3275
UniProt ID P55345
Cytogenetics 21q22.3
Summary Arginine methyltransferase that methylates the guanidino nitrogens of arginyl residues in proteins such as STAT3, FBL, histone H4. Acts as a coactivator (with NCOA2) of the androgen receptor (AR)-mediated transactivation. Acts as a coactivator (with estrogen) of estrogen receptor (ER)-mediated transactivation. Enhances PGR, PPARG, RARA-mediated transactivation. May inhibit NF-kappa-B transcription and promote apoptosis. Represses E2F1 transcriptional activity (in a RB1-dependent manner). May be involved in growth regulation.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:PRMT2 (NM_206962) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH318590 PRMT2 MS Standard C13 and N15-labeled recombinant protein (NP_001526) 10 ug
$3,255.00
LC400590 PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC404196 PRMT2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400590 Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 2 100 ug
$436.00
LY404196 Transient overexpression lysate of protein arginine methyltransferase 2 (PRMT2), transcript variant 1 100 ug
$436.00
TP300461 Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 1, 20 µg 20 ug
$737.00
TP318590 Recombinant protein of human protein arginine methyltransferase 2 (PRMT2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.