MVD (NM_002461) Human Mass Spec Standard

SKU
PH300451
MVD MS Standard C13 and N15-labeled recombinant protein (NP_002452)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200451]
Predicted MW 43.4 kDa
Protein Sequence
Protein Sequence
>RC200451 protein sequence
Red=Cloning site Green=Tags(s)

MASEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTEDRIWLNGR
EEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSSLSCKVHVASVNNFPTAAGLASSAAGYACLAYTLAR
VYGVESDLSEVARRGSGSACRSLYGGFVEWQMGEQADGKDSIARQVAPESHWPELRVLILVVSAEKKLTG
STVGMRASVETSPLLRFRAESVVPARMAEMARCIRERDFPSFAQLTMKDSNQFHATCLDTFPPISYLNAI
SWRIIHLVHRFNAHHGDTKVAYTFDAGPNAVIFTLDDTVAEFVAAVWHGFPPGSNGDTFLKGLQVRPAPL
SAELQAALAMEPTPGGVKYIIVTQVGPGPQILDDPCAHLLGPDGLPKPAA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002452
RefSeq Size 1812
RefSeq ORF 1200
Synonyms FP17780; MDDase; MPD; POROK7
Locus ID 4597
UniProt ID P53602
Cytogenetics 16q24.2
Summary The enzyme mevalonate pyrophosphate decarboxylase catalyzes the conversion of mevalonate pyrophosphate into isopentenyl pyrophosphate in one of the early steps in cholesterol biosynthesis. It decarboxylates and dehydrates its substrate while hydrolyzing ATP. [provided by RefSeq, Jul 2008]
Protein Pathways Metabolic pathways, Terpenoid backbone biosynthesis
Write Your Own Review
You're reviewing:MVD (NM_002461) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC419305 MVD HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY419305 Transient overexpression lysate of mevalonate (diphospho) decarboxylase (MVD) 100 ug
$436.00
TP300451 Recombinant protein of human mevalonate (diphospho) decarboxylase (MVD), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.