NAPG (NM_003826) Human Mass Spec Standard

SKU
PH300450
NAPG MS Standard C13 and N15-labeled recombinant protein (NP_003817)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200450]
Predicted MW 34.7 kDa
Protein Sequence
Protein Sequence
>RC200450 protein sequence
Red=Cloning site Green=Tags(s)

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRA
LFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQT
ANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDY
VAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGI
KKKSPATPQAKPDGVTATAADEEEDEYSGGLC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003817
RefSeq Size 3729
RefSeq ORF 936
Synonyms GAMMASNAP
Locus ID 8774
UniProt ID Q99747
Cytogenetics 18p11.22
Summary This gene encodes soluble NSF attachment protein gamma. The soluble NSF attachment proteins (SNAPs) enable N-ethyl-maleimide-sensitive fusion protein (NSF) to bind to target membranes. NSF and SNAPs appear to be general components of the intracellular membrane fusion apparatus, and their action at specific sites of fusion must be controlled by SNAP receptors particular to the membranes being fused. The product of this gene mediates platelet exocytosis and controls the membrane fusion events of this process.[provided by RefSeq, Dec 2008]
Write Your Own Review
You're reviewing:NAPG (NM_003826) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418393 NAPG HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418393 Transient overexpression lysate of N-ethylmaleimide-sensitive factor attachment protein, gamma (NAPG) 100 ug
$436.00
TP300450 Recombinant protein of human N-ethylmaleimide-sensitive factor attachment protein, gamma (NAPG), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.