Necdin (NDN) (NM_002487) Human Mass Spec Standard

SKU
PH300448
NDN MS Standard C13 and N15-labeled recombinant protein (NP_002478)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200448]
Predicted MW 36.1 kDa
Protein Sequence
Protein Sequence
>RC200448 protein sequence
Red=Cloning site Green=Tags(s)

MSEQSKDLSDPNFAAEAPNSEVHSSPGVSEGVPPSATLAEPQSPPLGPTAAPQAAPPPQAPNDEGDPKAL
QQAAEEGRAHQAPSAAQPGPAPPAPAQLVQKAHELMWYVLVKDQKKMIIWFPDMVKDVIGSYKKWCRSIL
RRTSLILARVFGLHLRLTSLHTMEFALVKALEPEELDRVALSNRMPMTGLLLMILSLIYVKGRGARESAV
WNVLRILGLRPWKKHSTFGDVRKLITEEFVQMNYLKYQRVPYVEPPEYEFFWGSRASREITKMQIMEFLA
RVFKKDPQAWPSRYREALEEARALREANPTAHYPRSSVSED

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_002478
RefSeq Size 1897
RefSeq ORF 963
Synonyms HsT16328; PWCR
Locus ID 4692
UniProt ID Q99608
Cytogenetics 15q11.2
Summary This intronless gene is located in the Prader-Willi syndrome deletion region. It is an imprinted gene and is expressed exclusively from the paternal allele. Studies in mouse suggest that the protein encoded by this gene may suppress growth in postmitotic neurons. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome, Transcription Factors
Write Your Own Review
You're reviewing:Necdin (NDN) (NM_002487) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC400887 NDN HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY400887 Transient overexpression lysate of necdin homolog (mouse) (NDN) 100 ug
$436.00
TP300448 Recombinant protein of human necdin homolog (mouse) (NDN), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.