VAMP8 (NM_003761) Human Mass Spec Standard

SKU PH300405

VAMP8 MS Standard C13 and N15-labeled recombinant protein (NP_003752)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200405]
• Predicted MW: 11.4 kDa
• Protein Sequence:
  Protein Sequence

  >RC200405 protein sequence; Red=Cloning site Green=Tags(s); ; MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW; WKNVKMIVLICVIVFIIILFIVLFATGAFS; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_003752
• RefSeq Size: 790
• RefSeq ORF: 300
• Synonyms: EDB; VAMP-8
• Locus ID: 8673
• UniProt ID: Q9BV40
• Cytogenetics: 2p11.2
• Summary: This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.[provided by RefSeq, Jun 2010]
• Protein Families: Stem cell - Pluripotency, Transmembrane
• Protein Pathways: SNARE interactions in vesicular transport