OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

VAMP8 (NM_003761) Human Mass Spec Standard

Be the first to review this product
SKU
PH300405
VAMP8 MS Standard C13 and N15-labeled recombinant protein (NP_003752)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA328119 VAMP8 Antibody (N-term)
400 ul
$645.00
LY401238 Transient overexpression lysate of vesicle-associated membrane protein 8 (endobrevin) (VAMP8) (as WB positive control) 100 ug
$436.00

Other products for "VAMP8 or NM_003761"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200405
Predicted MW 11.4 kDa
Protein Sequence
Protein Sequence
>RC200405 protein sequence
Red=Cloning site Green=Tags(s)

MEEASEGGGNDRVRNLQSEVEGVKNIMTQNVERILARGENLEHLRNKTEDLEATSEHFKTTSQKVARKFW
WKNVKMIVLICVIVFIIILFIVLFATGAFS

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_003752
RefSeq Size 790
RefSeq ORF 300
Synonyms EDB; VAMP-8
Locus ID 8673
UniProt ID Q9BV40
Cytogenetics 2p11.2
Summary This gene encodes an integral membrane protein that belongs to the synaptobrevin/vesicle-associated membrane protein subfamily of soluble N-ethylmaleimide-sensitive factor attachment protein receptors (SNAREs). The encoded protein is involved in the fusion of synaptic vesicles with the presynaptic membrane.provided by RefSeq, Jun 2010
Protein Families Stem cell - Pluripotency, Transmembrane
Protein Pathways SNARE interactions in vesicular transport
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "VAMP8" proteins (3)
SKU Description Size Price
LC401238 Lyophilized VAMP8 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY401238 Transient overexpression lysate of vesicle-associated membrane protein 8 (endobrevin) (VAMP8) (as WB positive control) 100 ug
$436.00
TP300405 Recombinant protein of human vesicle-associated membrane protein 8 (endobrevin) (VAMP8), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products