ZNF174 (NM_001032292) Human Mass Spec Standard

SKU
PH300400
ZNF174 MS Standard C13 and N15-labeled recombinant protein (NP_001027463)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200400]
Predicted MW 26.9 kDa
Protein Sequence
Protein Sequence
>RC200400 protein sequence
Red=Cloning site Green=Tags(s)

MAAKMEITLSSNTEASSKQERHIIAKLEEKRGPPLQKNCPDPELCRQSFRRFCYQEVSGPQEALSQLRQL
CRQWLQPELHTKEQILELLVMEQFLTILPPEIQARVRHRCPMSSKEIVTLVEDFHRASKKPKQWVAVCMQ
GQKVLLEKTGSQLGEQELPDFQPQTPRRDLRESSPAEPSQAGAYDRLSPHHWEKSPLLQEPTPKLAGTEL
LIEKTDPNMATDELPCKLWLSFIA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_001027463
RefSeq Size 1593
RefSeq ORF 702
Synonyms ZSCAN8
Locus ID 7727
UniProt ID Q15697
Cytogenetics 16p13.3
Summary This gene encodes a protein with three Cys2-His2-type zinc fingers in the carboxy-terminus, a putative nuclear localization signal, and an amino-terminus SCAN box which forms homodimers. This protein is believed to function as a transcriptional repressor. Alternative splicing results in multiple transcript variants encoding distinct isoforms. [provided by RefSeq, Dec 2016]
Protein Families Transcription Factors
Write Your Own Review
You're reviewing:ZNF174 (NM_001032292) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC418676 ZNF174 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC422302 ZNF174 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY418676 Transient overexpression lysate of zinc finger protein 174 (ZNF174), transcript variant 1 100 ug
$436.00
LY422302 Transient overexpression lysate of zinc finger protein 174 (ZNF174), transcript variant 2 100 ug
$436.00
TP300400 Recombinant protein of human zinc finger protein 174 (ZNF174), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP761180 Purified recombinant protein of Human zinc finger protein 174 (ZNF174), transcript variant 1, full length, with N-terminal HIS tag, expressed in E. coli, 50ug 50 ug
$261.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.