Ferredoxin Reductase (FDXR) (NM_024417) Human Mass Spec Standard

SKU
PH300363
FDXR MS Standard C13 and N15-labeled recombinant protein (NP_077728)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200363]
Predicted MW 49.9 kDa
Protein Sequence
Protein Sequence
>RC200363 representing NM_024417
Red=Cloning site Green=Tags(s)

MASRCWRWWGWSAWPRTRLPPAGSTPSFCHHFSTQEKTPQICVVGSGPAGFYTAQHLLKHPQAHVDIYEK
QPVPFGLVRFGVAPDHPEVKNVINTFTQTAHSGRCAFWGNVEVGRDVTVPELREAYHAVVLSYGAEDHRA
LEIPGEELPGVCSARAFVGWYNGLPENQELEPDLSCDTAVILGQGNVALDVARILLTPPEHLERTDITKA
ALGVLRQSRVKTVWLVGRRGPLQVAFTIKELREMIQLPGARPILDPVDFLGLQDKIKEVPRPRKRLTELL
LRTATEKPGPAEAARQASASRAWGLRFFRSPQQVLPSPDGRRAAGVRLAVTRLEGVDEATRAVPTGDMED
LPCGLVLSSIGYKSRPVDPSVPFDSKLGVIPNVEGRVMDVPGLYCSGWVKRGPTGVIATTMTDSFLTGQM
LLQDLKAGLLPSGPRPGYAAIQALLSSRGVRPVSFSDWEKLDAEEVARGQGTGKPREKLVDPQEMLRLLG
H

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_077728
RefSeq Size 1918
RefSeq ORF 1473
Synonyms ADR; ADXR; ANOA
Locus ID 2232
UniProt ID P22570
Cytogenetics 17q25.1
Summary This gene encodes a mitochondrial flavoprotein that initiates electron transport for cytochromes P450 receiving electrons from NADPH. Multiple alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Apr 2012]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:Ferredoxin Reductase (FDXR) (NM_024417) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402986 FDXR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC418195 FDXR HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY402986 Transient overexpression lysate of ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 1 100 ug
$436.00
LY418195 Transient overexpression lysate of ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 2 100 ug
$665.00
TP300363 Recombinant protein of human ferredoxin reductase (FDXR), nuclear gene encoding mitochondrial protein, transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.