PRPF4 (NM_004697) Human Mass Spec Standard

SKU
PH300360
PRPF4 MS Standard C13 and N15-labeled recombinant protein (NP_004688)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200360]
Predicted MW 58.4 kDa
Protein Sequence
Protein Sequence
>RC200360 protein sequence
Red=Cloning site Green=Tags(s)

MASSRASSTQATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSG
EVFEIEEHISERQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVV
GTDALKKTKKDDEKSKKSKEEYQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQ
MQELHKSLRSLNNFCSQIGDDRPISYCHFSPNSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIV
FHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEGHTVRVARVMWHPSGRFLGTTCYDRSWRLW
DLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIMFLEGHLKEIYGINFSPNGY
HIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPGWSPLKTLAG
HEGKVMGLDISSDGQLIATCSYDRTFKLWMAE

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004688
RefSeq Size 2941
RefSeq ORF 1566
Synonyms HPRP4; HPRP4P; PRP4; Prp4p; RP70; SNRNP60
Locus ID 9128
UniProt ID O43172
Cytogenetics 9q32
Summary The protein encoded by this gene is part of a heteromeric complex that binds U4, U5, and U6 small nuclear RNAs and is involved in pre-mRNA splicing. The encoded protein also is a mitotic checkpoint protein and a regulator of chemoresistance in human ovarian cancer. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2016]
Protein Pathways Spliceosome
Write Your Own Review
You're reviewing:PRPF4 (NM_004697) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417825 PRPF4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417825 Transient overexpression lysate of PRP4 pre-mRNA processing factor 4 homolog (yeast) (PRPF4) 100 ug
$436.00
TP300360 Recombinant protein of human PRP4 pre-mRNA processing factor 4 homolog (yeast) (PRPF4), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.