RAB33A (NM_004794) Human Mass Spec Standard

SKU
PH300351
RAB33A MS Standard C13 and N15-labeled recombinant protein (NP_004785)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200351]
Predicted MW 26.6 kDa
Protein Sequence
Protein Sequence
>RC200351 protein sequence
Red=Cloning site Green=Tags(s)

MAQPILGHGSLQPASAAGLASLELDSSLDQYVQIRIFKIIVIGDSNVGKTCLTFRFCGGTFPDKTEATIG
VDFREKTVEIEGEKIKVQVWDTAGQERFRKSMVEHYYRNVHAVVFVYDVTKMTSFTNLKMWIQECNGHAV
PPLVPKVLVGNKCDLREQIQVPSNLALKFADAHNMLLFETSAKDPKESQNVESIFMCLACRLKAQKSLLY
RDAERQQGKVQKLEFPQEANSKTSCPC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004785
RefSeq Size 1128
RefSeq ORF 711
Synonyms RabS10
Locus ID 9363
UniProt ID Q14088
Cytogenetics Xq26.1
Summary The protein encoded by this gene belongs to the small GTPase superfamily, Rab family. It is GTP-binding protein and may be involved in vesicle transport. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:RAB33A (NM_004794) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417747 RAB33A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417747 Transient overexpression lysate of RAB33A, member RAS oncogene family (RAB33A) 100 ug
$436.00
TP300351 Recombinant protein of human RAB33A, member RAS oncogene family (RAB33A), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.