Aldolase C (ALDOC) (NM_005165) Human Mass Spec Standard

SKU
PH300333
ALDOC MS Standard C13 and N15-labeled recombinant protein (NP_005156)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200333]
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC200333 protein sequence
Red=Cloning site Green=Tags(s)

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV
KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK
DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA
SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG
GAAAQSLYIANHAY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005156
RefSeq Size 1665
RefSeq ORF 1092
Synonyms ALDC
Locus ID 230
UniProt ID P09972
Cytogenetics 17q11.2
Summary This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. [provided by RefSeq, Jul 2008]
Protein Pathways Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway
Write Your Own Review
You're reviewing:Aldolase C (ALDOC) (NM_005165) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC417475 ALDOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY417475 Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC) 100 ug
$436.00
TP300333 Recombinant protein of human aldolase C, fructose-bisphosphate (ALDOC), 20 µg 20 ug
$737.00
TP721085 Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC) 10 ug
$250.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.