OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

Aldolase C (ALDOC) (NM_005165) Human Mass Spec Standard

Be the first to review this product
SKU
PH300333
ALDOC MS Standard C13 and N15-labeled recombinant protein (NP_005156)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA373451 ALDOC Rabbit polyclonal Antibody
100 ul
$410.00
LY417475 Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC) (as WB positive control) 100 ug
$436.00

Other products for "Aldolase C or NM_005165"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200333
Predicted MW 39.5 kDa
Protein Sequence
Protein Sequence
>RC200333 protein sequence
Red=Cloning site Green=Tags(s)

MPHSYPALSAEQKKELSDIALRIVAPGKGILAADESVGSMAKRLSQIGVENTEENRRLYRQVLFSADDRV
KKCIGGVIFFHETLYQKDDNGVPFVRTIQDKGIVVGIKVDKGVVPLAGTDGETTTQGLDGLSERCAQYKK
DGADFAKWRCVLKISERTPSALAILENANVLARYASICQQNGIVPIVEPEILPDGDHDLKRCQYVTEKVL
AAVYKALSDHHVYLEGTLLKPNMVTPGHACPIKYTPEEIAMATVTALRRTVPPAVPGVTFLSGGQSEEEA
SFNLNAINRCPLPRPWALTFSYGRALQASALNAWRGQRDNAGAATEEFIKRAEVNGLAAQGKYEGSGEDG
GAAAQSLYIANHAY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_005156
RefSeq Size 1665
RefSeq ORF 1092
Synonyms ALDC
Locus ID 230
UniProt ID P09972
Cytogenetics 17q11.2
Summary This gene encodes a member of the class I fructose-biphosphate aldolase gene family. Expressed specifically in the hippocampus and Purkinje cells of the brain, the encoded protein is a glycolytic enzyme that catalyzes the reversible aldol cleavage of fructose-1,6-biphosphate and fructose 1-phosphate to dihydroxyacetone phosphate and either glyceraldehyde-3-phosphate or glyceraldehyde, respectively. provided by RefSeq, Jul 2008
Protein Pathways Fructose and mannose metabolism, Glycolysis / Gluconeogenesis, Metabolic pathways, Pentose phosphate pathway
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "Aldolase C" proteins (4)
SKU Description Size Price
LC417475 Lyophilized ALDOC HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417475 Transient overexpression lysate of aldolase C, fructose-bisphosphate (ALDOC) (as WB positive control) 100 ug
$436.00
TP300333 Recombinant protein of human aldolase C, fructose-bisphosphate (ALDOC), 20 µg 20 ug
$737.00
TP721085 Purified recombinant protein of Human aldolase C, fructose-bisphosphate (ALDOC) 10 ug
$260.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products