CALM3 (NM_005184) Human Mass Spec Standard

SKU PH300331

CALM3 MS Standard C13 and N15-labeled recombinant protein (NP_005175)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200331]
• Predicted MW: 16.8 kDa
• Protein Sequence:
  Protein Sequence

  >RC200331 protein sequence; Red=Cloning site Green=Tags(s); ; MADQLTEEQIAEFKEAFSLFDKDGDGTITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFL; TMMARKMKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQVNYE; EFVQMMTAK; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_005175
• RefSeq Size: 2277
• RefSeq ORF: 447
• Synonyms: CALM; CaM; CAM1; CAM2; CAMB; CaMIII; CPVT6; HEL-S-72; LQT16; PHKD; PHKD3
• Locus ID: 808
• UniProt ID: P0DP23
• Cytogenetics: 19q13.32
• Summary: This gene encodes a member of a family of proteins that binds calcium and functions as a enzymatic co-factor. Activity of this protein is important in the regulation of the cell cycle and cytokinesis. Multiple alternatively spliced transcript variants have been observed at this gene. [provided by RefSeq, Aug 2016]
• Protein Families: Druggable Genome
• Protein Pathways: Alzheimer's disease, Calcium signaling pathway, Glioma, GnRH signaling pathway, Insulin signaling pathway, Long-term potentiation, Melanogenesis, Neurotrophin signaling pathway, Olfactory transduction, Oocyte meiosis, Phosphatidylinositol signaling system, Vascular smooth muscle contraction