LSM1 (NM_014462) Human Mass Spec Standard

SKU
PH300288
LSM1 MS Standard C13 and N15-labeled recombinant protein (NP_055277)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200288]
Predicted MW 15.2 kDa
Protein Sequence
Protein Sequence
>RC200288 protein sequence
Red=Cloning site Green=Tags(s)

MNYMPGTASLIEDIDKKHLVLLRDGRTLIGFLRSIDQFANLVLHQTVERIHVGKKYGDIPRGIFVVRGEN
VVLLGEIDLEKESDTPLQQVSIEEILEEQRVEQQTKLEAEKLKVQALKDRGLSIPRADTLDEY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055277
RefSeq Size 1161
RefSeq ORF 399
Synonyms CASM; YJL124C
Locus ID 27257
UniProt ID O15116
Cytogenetics 8p11.23
Summary This gene encodes a member of the LSm family of RNA-binding proteins. LSm proteins form stable heteromers that bind specifically to the 3'-terminal oligo(U) tract of U6 snRNA and may play a role in pre-mRNA splicing by mediating U4/U6 snRNP formation. Increased expression of this gene may play a role in cellular transformation and the progression of several malignancies including lung cancer, mesothelioma and breast cancer. Alternatively spliced transcript variants have been observed for this gene, and a pseudogene of this gene is located on the short arm of chromosome 9. [provided by RefSeq, Nov 2011]
Protein Families Stem cell - Pluripotency
Protein Pathways RNA degradation
Write Your Own Review
You're reviewing:LSM1 (NM_014462) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415265 LSM1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415265 Transient overexpression lysate of LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) 100 ug
$436.00
TP300288 Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720235 Recombinant protein of human LSM1 homolog, U6 small nuclear RNA associated (S. cerevisiae) (LSM1) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.