Annexin A10 (ANXA10) (NM_007193) Human Mass Spec Standard

SKU
PH300268
ANXA10 MS Standard C13 and N15-labeled recombinant protein (NP_009124)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200268]
Predicted MW 37.3 kDa
Protein Sequence
Protein Sequence
>RC200268 protein sequence
Red=Cloning site Green=Tags(s)

MFCGDYVQGTIFPAPNFNPIMDAQMLGGALQGFDCDKDMLINILTQRCNAQRMMIAEAYQSMYGRDLIGD
MREQLSDHFKDVMAGLMYPPPLYDAHELWHAMKGVGTDENCLIEILASRTNGEIFQMREAYCLQYSNNLQ
EDIYSETSGHFRDTLMNLVQGTREEGYTDPAMAAQDAMVLWEACQQKTGEHKTMLQMILCNKSYQQLRLV
FQEFQNISGQDMVDAINECYDGYFQELLVAIVLCVRDKPAYFAYRLYSAIHDFGFHNKTVIRILIARSEI
DLLTIRKRYKERYGKSLFHDIRNFASGHYKKALLAICAGDAEDY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009124
RefSeq Size 1447
RefSeq ORF 972
Synonyms ANX14
Locus ID 11199
UniProt ID Q9UJ72
Cytogenetics 4q32.3
Summary This gene encodes a member of the annexin family. Members of this calcium-dependent phospholipid-binding protein family play a role in the regulation of cellular growth and in signal transduction pathways. The function of this gene has not yet been determined. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:Annexin A10 (ANXA10) (NM_007193) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402103 ANXA10 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402103 Transient overexpression lysate of annexin A10 (ANXA10) 100 ug
$436.00
TP300268 Recombinant protein of human annexin A10 (ANXA10), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720867 Purified recombinant protein of Human annexin A10 (ANXA10) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.