RAB31 (NM_006868) Human Mass Spec Standard

SKU
PH300249
RAB31 MS Standard C13 and N15-labeled recombinant protein (NP_006859)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200249]
Predicted MW 21.7 kDa
Protein Sequence
Protein Sequence
>RC200249 protein sequence
Red=Cloning site Green=Tags(s)

MMAIRELKVCLLGDTGVGKSSIVCRFVQDHFDHNISPTIGASFMTKTVPCGNELHKFLIWDTAGQERFHS
LAPMYYRGSAAAVIVYDITKQDSFYTLKKWVKELKEHGPENIVMAIAGNKCDLSDIREVPLKDAKEYAES
IGAIVVETSAKNAINIEELFQGISRQIPPLDPHENGNNGTIKVEKPTMQASRRCC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006859
RefSeq Size 4009
RefSeq ORF 585
Synonyms Rab22B
Locus ID 11031
UniProt ID Q13636
Cytogenetics 18p11.22
Summary Small GTP-binding proteins of the RAB family, such as RAB31, play essential roles in vesicle and granule targeting (Bao et al., 2002 [PubMed 11784320]).[supplied by OMIM, Jul 2009]
Protein Families Druggable Genome
Protein Pathways Endocytosis
Write Your Own Review
You're reviewing:RAB31 (NM_006868) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402053 RAB31 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402053 Transient overexpression lysate of RAB31, member RAS oncogene family (RAB31) 100 ug
$436.00
TP300249 Recombinant protein of human RAB31, member RAS oncogene family (RAB31), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.