Sumo 3 (SUMO3) (NM_006936) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200241] |
Predicted MW | 11.6 kDa |
Protein Sequence |
Protein Sequence
>RC200241 protein sequence
Red=Cloning site Green=Tags(s) MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_008867 |
RefSeq Size | 1831 |
RefSeq ORF | 309 |
Synonyms | SMT3A; Smt3B; SMT3H1; SUMO-3 |
Locus ID | 6612 |
UniProt ID | P55854 |
Cytogenetics | 21q22.3 |
Summary | This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014] |
Protein Families | Druggable Genome |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC402068 | SUMO3 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY402068 | Transient overexpression lysate of SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) | 100 ug |
$436.00
|
|
TP300241 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720508 | Recombinant protein of human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) | 10 ug |
$130.00
|
|
TP721152 | Purified recombinant protein of Human SMT3 suppressor of mif two 3 homolog 3 (S. cerevisiae) (SUMO3) | 10 ug |
$155.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.