Sumo 3 (SUMO3) (NM_006936) Human Mass Spec Standard

SKU PH300241

SUMO3 MS Standard C13 and N15-labeled recombinant protein (NP_008867)

Product Data

• Tag: C-Myc/DDK
• Species: Human
• Expression Host: HEK293
• Expression cDNA Clone or AA Sequence: [RC200241]
• Predicted MW: 11.6 kDa
• Protein Sequence:
  Protein Sequence

  >RC200241 protein sequence; Red=Cloning site Green=Tags(s); ; MSEEKPKEGVKTENDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETD; TPAQLEMEDEDTIDVFQQQTGGVPESSLAGHSF; ; myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Concentration: >0.05 µg/µL as determined by microplate BCA method
• Labeling Method: Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
• Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3
• Storage: Store at -80°C. Avoid repeated freeze-thaw cycles.
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Shipping: Dry Ice

Reference Data

• RefSeq: NP_008867
• RefSeq Size: 1831
• RefSeq ORF: 309
• Synonyms: SMT3A; Smt3B; SMT3H1; SUMO-3
• Locus ID: 6612
• UniProt ID: P55854
• Cytogenetics: 21q22.3
• Summary: This gene encodes a member of the small ubiquitin-related modifier (SUMO) family of eukaryotic proteins. The encoded protein is covalently conjugated to other proteins via a post-translation modification known as sumoylation. Sumoylation may play a role in a wide variety of cellular processes, including nuclear transport, DNA replication and repair, mitosis, transcriptional regulation, and signal transduction. Alternatively spliced transcript variants encoding distinct proteins have been described. [provided by RefSeq, Feb 2014]
• Protein Families: Druggable Genome