PACSIN2 (NM_007229) Human Mass Spec Standard

SKU
PH300237
PACSIN2 MS Standard C13 and N15-labeled recombinant protein (NP_009160)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200237]
Predicted MW 55.7 kDa
Protein Sequence
Protein Sequence
>RC200237 protein sequence
Red=Cloning site Green=Tags(s)

MSVTYDDSVGVEVSSDSFWEVGNYKRTVKRIDDGHRLCSDLMNCLHERARIEKAYAQQLTEWARRWRQLV
EKGPQYGTVEKAWMAFMSEAERVSELHLEVKASLMNDDFEKIKNWQKEAFHKQMMGGFKETKEAEDGFRK
AQKPWAKKLKEVEAAKKAHHAACKEEKLAISREANSKADPSLNPEQLKKLQDKIEKCKQDVLKTKEKYEK
SLKELDQGTPQYMENMEQVFEQCQQFEEKRLRFFREVLLEVQKHLDLSNVAGYKAIYHDLEQSIRAADAV
EDLRWFRANHGPGMAMNWPQFEEWSADLNRTLSRREKKKATDGVTLTGINQTGDQSLPSKPSSTLNVPSN
PAQSAQSQSSYNPFEDEDDTGSTVSEKDDTKAKNVSSYEKTQSYPTDWSDDESNNPFSSTDANGDSNPFD
DDATSGTEVRVRALYDYEGQEHDELSFKAGDELTKMEDEDEQGWCKGRLDNGQVGLYPANYVEAIQ

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_009160
RefSeq Size 3292
RefSeq ORF 1458
Synonyms SDPII
Locus ID 11252
UniProt ID Q9UNF0
Cytogenetics 22q13.2
Summary This gene is a member of the protein kinase C and casein kinase substrate in neurons family. The encoded protein is involved in linking the actin cytoskeleton with vesicle formation by regulating tubulin polymerization. Alternative splicing results in multiple transcript variants. [provided by RefSeq, May 2010]
Write Your Own Review
You're reviewing:PACSIN2 (NM_007229) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC416115 PACSIN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC433094 PACSIN2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY416115 Transient overexpression lysate of protein kinase C and casein kinase substrate in neurons 2 (PACSIN2) 100 ug
$436.00
LY433094 Transient overexpression lysate of protein kinase C and casein kinase substrate in neurons 2 (PACSIN2), transcript variant 3 100 ug
$436.00
TP300237 Recombinant protein of human protein kinase C and casein kinase substrate in neurons 2 (PACSIN2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.