TOLLIP (NM_019009) Human Mass Spec Standard

SKU
PH300227
TOLLIP MS Standard C13 and N15-labeled recombinant protein (NP_061882)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200227]
Predicted MW 30.3 kDa
Protein Sequence
Protein Sequence
>RC200227 protein sequence
Red=Cloning site Green=Tags(s)

MATTVSTQRGPVYIGELPQDFLRITPTQQQRQVQLDAQAAQQLQYGGAVGTVGRLNITVVQAKLAKNYGM
TRMDPYCRLRLGYAVYETPTAHNGAKNPRWNKVIHCTVPPGVDSFYLEIFDERAFSMDDRIAWTHITIPE
SLRQGKVEDKWYSLSGRQGDDKEGMINLVMSYALLPAAMVMPPQPVVLMPTVYQQGVGYVPITGMPAVCS
PGMVPVALPPAAVNAQPRCSEEDLKAIQDMFPNMDQEVIRSVLEAQRGNKDAAINSLLQMGEEP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_061882
RefSeq Size 3665
RefSeq ORF 822
Synonyms IL-1RAcPIP
Locus ID 54472
UniProt ID Q9H0E2
Cytogenetics 11p15.5
Summary This gene encodes a ubiquitin-binding protein that interacts with several Toll-like receptor (TLR) signaling cascade components. The encoded protein regulates inflammatory signaling and is involved in interleukin-1 receptor trafficking and in the turnover of IL1R-associated kinase. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jan 2016]
Protein Families Druggable Genome
Protein Pathways Toll-like receptor signaling pathway
Write Your Own Review
You're reviewing:TOLLIP (NM_019009) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402724 TOLLIP HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402724 Transient overexpression lysate of toll interacting protein (TOLLIP) 100 ug
$436.00
TP300227 Recombinant protein of human toll interacting protein (TOLLIP), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720557 Recombinant protein of human toll interacting protein (TOLLIP) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.