DNAJB11 (NM_016306) Human Mass Spec Standard

SKU
PH300216
DNAJB11 MS Standard C13 and N15-labeled recombinant protein (NP_057390)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200216]
Predicted MW 40.5 kDa
Protein Sequence
Protein Sequence
>RC200216 protein sequence
Red=Cloning site Green=Tags(s)

MAPQNLSTFCLLLLYLIGAVIAGRDFYKILGVPRSASIKDIKKAYRKLALQLHPDRNPDDPQAQEKFQDL
GAAYEVLSDSEKRKQYDTYGEEGLKDGHQSSHGDIFSHFFGDFGFMFGGTPRQQDRNIPRGSDIIVDLEV
TLEEVYAGNFVEVVRNKPVARQAPGKRKCNCRQEMRTTQLGPGRFQMTQEVVCDECPNVKLVNEERTLEV
EIEPGVRDGMEYPFIGEGEPHVDGEPGDLRFRIKVVKHPIFERRGDDLYTNVTISLVESLVGFEMDITHL
DGHKVHISRDKITRPGAKLWKKGEGLPNFDNNNIKGSLIITFDVDFPKEQLTEEAREGIKQLLKQGSVQK
VYNGLQGY

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057390
RefSeq Size 1698
RefSeq ORF 1074
Synonyms ABBP-2; ABBP2; Dj-9; DJ9; EDJ; ERdj3; ERj3; ERj3p; PKD6; PRO1080; UNQ537
Locus ID 51726
UniProt ID Q9UBS4
Cytogenetics 3q27.3
Summary This gene encodes a soluble glycoprotein of the endoplasmic reticulum (ER) lumen that functions as a co-chaperone of binding immunoglobulin protein, a 70 kilodalton heat shock protein chaperone required for the proper folding and assembly of proteins in the ER. The encoded protein contains a highly conserved J domain of about 70 amino acids with a characteristic His-Pro-Asp (HPD) motif and may regulate the activity of binding immunoglobulin protein by stimulating ATPase activity. [provided by RefSeq, Mar 2014]
Protein Families Transmembrane
Write Your Own Review
You're reviewing:DNAJB11 (NM_016306) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402537 DNAJB11 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402537 Transient overexpression lysate of DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11) 100 ug
$436.00
TP300216 Recombinant protein of human DnaJ (Hsp40) homolog, subfamily B, member 11 (DNAJB11), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.