RPIP8 (RUNDC3A) (NM_006695) Human Mass Spec Standard

SKU
PH300211
RUNDC3A MS Standard C13 and N15-labeled recombinant protein (NP_006686)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200211]
Predicted MW 45.7 kDa
Protein Sequence
Protein Sequence
>RC200211 protein sequence
Red=Cloning site Green=Tags(s)

MEASFVQTTMALGLSSKKASSRNVAVERKNLITVCRFSVKTLLEKYTAEPIDDSSEEFVNFAAILEQILS
HRFKACAPAGPVSWFSSDGQRGFWDYIRLACSKVPNNCVSSIENMENISTARAKGRAWIRVALMEKRMSE
YITTALRDTRTTRRFYDSGAIMLRDEATILTGMLIGLSAIDFSFCLKGEVLDGKTPVVIDYTPYLKFTQS
YDYLTDEEERHSAESSTSEDNSPEHPYLPLVTDEDSWYSKWHKMEQKFRIVYAQKGYLEELVRLRESQLK
DLEAENRRLQLQLEEAAAQNQREKRELEGVILELQEQLTGLIPSDHAPLAQGSKELTTPLVNQWPSLGTL
NGAEGASNSKLYRRHSFMSTEPLSAEASLSSDSQRLGEGTRDEEPWGPIGSSEPN

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006686
RefSeq Size 1879
RefSeq ORF 1215
Synonyms RAP2IP; RPIP-8; RPIP8
Locus ID 10900
UniProt ID Q59EK9
Cytogenetics 17q21.31
Summary May act as an effector of RAP2A in neuronal cells.[UniProtKB/Swiss-Prot Function]
Write Your Own Review
You're reviewing:RPIP8 (RUNDC3A) (NM_006695) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402004 RUNDC3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428521 RUNDC3A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402004 Transient overexpression lysate of RUN domain containing 3A (RUNDC3A), transcript variant 2 100 ug
$436.00
LY428521 Transient overexpression lysate of RUN domain containing 3A (RUNDC3A), transcript variant 1 100 ug
$436.00
TP300211 Recombinant protein of human RUN domain containing 3A (RUNDC3A), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.