OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NT5C2 (NM_012229) Human Mass Spec Standard

Be the first to review this product
SKU
PH300194
NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_036361)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA308031 Rabbit Polyclonal antibody to NT5C2 (5'-nucleotidase, cytosolic II)
100 ul
$665.00
LY415891 Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1 (as WB positive control) 100 ug
$436.00

Other products for "NT5C2 or NM_012229"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200194
Predicted MW 65 kDa
Protein Sequence
Protein Sequence
>RC200194 protein sequence
Red=Cloning site Green=Tags(s)

MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF
ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK
FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY
KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ
SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG
DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV
EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE
E

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036361
RefSeq Size 3551
RefSeq ORF 1683
Synonyms cN-II; GMP; NT5B; PNT5; SPG45; SPG65
Locus ID 22978
UniProt ID P49902
Cytogenetics 10q24.32-q24.33
Summary This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides. provided by RefSeq, Oct 2011
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NT5C2" proteins (7)
SKU Description Size Price
PH325961 NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_001127845) 10 ug
$3,360.00
LC415891 Lyophilized NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC427403 Lyophilized NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY415891 Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1 (as WB positive control) 100 ug
$436.00
LY427403 Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2 (as WB positive control) 100 ug
$436.00
TP300194 Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1, 20 µg 20 ug
$737.00
TP325961 Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2, 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products