NT5C2 (NM_012229) Human Mass Spec Standard

SKU
PH300194
NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_036361)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200194]
Predicted MW 65 kDa
Protein Sequence
Protein Sequence
>RC200194 protein sequence
Red=Cloning site Green=Tags(s)

MSTSWSDRLQNAADMPANMDKHALKKYRREAYHRVFVNRSLAMEKIKCFGFDMDYTLAVYKSPEYESLGF
ELTVERLVSIGYPQELLSFAYDSTFPTRGLVFDTLYGNLLKVDAYGNLLVCAHGFNFIRGPETREQYPNK
FIQRDDTERFYILNTLFNLPETYLLACLVDFFTNCPRYTSCETGFKDGDLFMSYRSMFQDVRDAVDWVHY
KGSLKEKTVENLEKYVVKDGKLPLLLSRMKEVGKVFLATNSDYKYTDKIMTYLFDFPHGPKPGSSHRPWQ
SYFDLILVDARKPLFFGEGTVLRQVDTKTGKLKIGTYTGPLQHGIVYSGGSSDTICDLLGAKGKDILYIG
DHIFGDILKSKKRQGWRTFLVIPELAQELHVWTDKSSLFEELQSLDIFLAELYKHLDSSSNERPDISSIQ
RRIKKVTHDMDMCYGMMGSLFRSGSRQTLFASQVMRYADLYAASFINLLYYPFSYLFRAAHVLMPHESTV
EHTHVDINEMESPLATRNRTSVDFKDTDYKRHQLTRSISEIKPPNLFPLAPQEITHCHDEDDDEEEEEEE
E

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_036361
RefSeq Size 3551
RefSeq ORF 1683
Synonyms cN-II; GMP; NT5B; PNT5; SPG45; SPG65
Locus ID 22978
UniProt ID P49902
Cytogenetics 10q24.32-q24.33
Summary This gene encodes a hydrolase that serves as an important role in cellular purine metabolism by acting primarily on inosine 5'-monophosphate and other purine nucleotides. [provided by RefSeq, Oct 2011]
Protein Pathways Metabolic pathways, Nicotinate and nicotinamide metabolism, Purine metabolism, Pyrimidine metabolism
Write Your Own Review
You're reviewing:NT5C2 (NM_012229) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH325961 NT5C2 MS Standard C13 and N15-labeled recombinant protein (NP_001127845) 10 ug
$3,255.00
LC415891 NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC427403 NT5C2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415891 Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1 100 ug
$436.00
LY427403 Transient overexpression lysate of 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2 100 ug
$436.00
TP300194 Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 1, 20 µg 20 ug
$737.00
TP325961 Recombinant protein of human 5'-nucleotidase, cytosolic II (NT5C2), transcript variant 2, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.