NDE1 (NM_017668) Human Mass Spec Standard

SKU
PH300179
NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_060138)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200179]
Predicted MW 37.7 kDa
Protein Sequence
Protein Sequence
>RC200179 protein sequence
Red=Cloning site Green=Tags(s)

MEDSGKTFSSEEEEANYWKDLAMTYKQRAENTQEELREFQEGSREYEAELETQLQQIETRNRDLLSENNR
LRMELETIKEKFEVQHSEGYRQISALEDDLAQTKAIKDQLQKYIRELEQANDDLERAKRATIMSLEDFEQ
RLNQAIERNAFLESELDEKENLLESVQRLKDEARDLRQELAVQQKQEKPRTPMPSSVEAERTDTAVQATG
SVPSTPIAHRGPSSSLNTPGSFRRGLDDSTGGTPLTPAARISALNIVGDLLRKVGALESKLASCRNLVYD
QSPNRTGGPASGRSSKNRDGGERRPSSTSVPLGDKGLDTSCRWLSKSTTRSSSSC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060138
RefSeq Size 3222
RefSeq ORF 1005
Synonyms HOM-TES-87; LIS4; MHAC; NDE; NUDE; NUDE1
Locus ID 54820
UniProt ID Q9NXR1
Cytogenetics 16p13.11
Summary This gene encodes a member of the nuclear distribution E (NudE) family of proteins. The encoded protein is localized at the centrosome and interacts with other centrosome components as part of a multiprotein complex that regulates dynein function. This protein plays an essential role in microtubule organization, mitosis and neuronal migration. Mutations in this gene cause lissencephaly 4, a disorder characterized by lissencephaly, severe brain atrophy, microcephaly, and severe cognitive disability. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Mar 2012]
Write Your Own Review
You're reviewing:NDE1 (NM_017668) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH327919 NDE1 MS Standard C13 and N15-labeled recombinant protein (NP_001137451) 10 ug
$3,255.00
LC402606 NDE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC428439 NDE1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402606 Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2 100 ug
$436.00
LY428439 Transient overexpression lysate of nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1 100 ug
$436.00
TP300179 Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP327919 Recombinant protein of human nudE nuclear distribution gene E homolog 1 (A. nidulans) (NDE1), transcript variant 1, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.