CHCHD3 (NM_017812) Human Mass Spec Standard

SKU
PH300174
CHCHD3 MS Standard C13 and N15-labeled recombinant protein (NP_060282)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200174]
Predicted MW 26.2 kDa
Protein Sequence
Protein Sequence
>RC200174 protein sequence
Red=Cloning site Green=Tags(s)

MGGTTSTRRVTFEADENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEEL
ALEQAKKESEDQKRLKQAKELDRERAAANEQLTRAILRERICSEEERAKAKHLARQLEEKDRVLKKQDAF
YKEQLARLEERSSEFYRVTTEQYQKAAEEVEAKFKRYESHPVCADLQAKILQCYRENTHQTLKCSALATQ
YMHCVNHAKQSMLEKGG

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060282
RefSeq Size 1622
RefSeq ORF 681
Synonyms Mic19; MICOS19; MINOS3; PPP1R22
Locus ID 54927
UniProt ID Q9NX63
Cytogenetics 7q32.3-q33
Summary The protein encoded by this gene is an inner mitochondrial membrane scaffold protein. Absence of the encoded protein affects the structural integrity of mitochondrial cristae and leads to reductions in ATP production, cell growth, and oxygen consumption. This protein is part of the mitochondrial contact site and cristae organizing system (MICOS). Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2015]
Write Your Own Review
You're reviewing:CHCHD3 (NM_017812) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413521 CHCHD3 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413521 Transient overexpression lysate of coiled-coil-helix-coiled-coil-helix domain containing 3 (CHCHD3) 100 ug
$436.00
TP300174 Recombinant protein of human coiled-coil-helix-coiled-coil-helix domain containing 3 (CHCHD3), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.