DUSP23 (NM_017823) Human Mass Spec Standard

SKU
PH300171
DUSP23 MS Standard C13 and N15-labeled recombinant protein (NP_060293)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200171]
Predicted MW 16.6 kDa
Protein Sequence
Protein Sequence
>RC200171 protein sequence
Red=Cloning site Green=Tags(s)

MGVQPPNFSWVLPGRLAGLALPRLPAHYQFLLDLGVRHLVSLTERGPPHSDSCPGLTLHRLRIPDFCPPA
PDQIDRFVQIVDEANARGEAVGVHCALGFGRTGTMLACYLVKERGLAAGDAIAEIRRLRPGSIETYEQEK
AVFQFYQRTK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060293
RefSeq Size 718
RefSeq ORF 450
Synonyms DUSP25; LDP-3; LDP3; MOSP; VHZ
Locus ID 54935
UniProt ID Q9BVJ7
Cytogenetics 1q23.2
Summary Protein phosphatase that mediates dephosphorylation of proteins phosphorylated on Tyr and Ser/Thr residues. In vitro, it can dephosphorylate p44-ERK1 (MAPK3) but not p54 SAPK-beta (MAPK10) in vitro. Able to enhance activation of JNK and p38 (MAPK14).[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome, Phosphatase
Write Your Own Review
You're reviewing:DUSP23 (NM_017823) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402621 DUSP23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402621 Transient overexpression lysate of dual specificity phosphatase 23 (DUSP23) 100 ug
$436.00
TP300171 Recombinant protein of human dual specificity phosphatase 23 (DUSP23), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.