CFAP298 (NM_021254) Human Mass Spec Standard

SKU
PH300169
C21orf59 MS Standard C13 and N15-labeled recombinant protein (NP_067077)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200169]
Predicted MW 33.2 kDa
Protein Sequence
Protein Sequence
>RC200169 protein sequence
Red=Cloning site Green=Tags(s)

MVLLHVKRGDESQFLLQAPGSTELEELTVQVARVYNGRLKVQRLCSEMEELAEHGIFLPPNMQGLTDDQI
EELKLKDEWGEKCVPSGGAVFKKDDIGRRNGQAPNEKMKQVLKKTIEEAKAIISKKQVEAGVCVTMEMVK
DALDQLRGAVMIVYPMGLPPYDPIRMEFENKEDLSGTQAGLNVIKEAEAQLWWAAKELRRTKKLSDYVGK
NEKTKIIAKIQQRGQGAPAREPIISSEEQKQLMLYYHRRQEELKRLEENDDDAYLNSPWADNTALKRHFH
GVKDIKWRPR

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_067077
RefSeq Size 1427
RefSeq ORF 870
Synonyms C21orf48; C21orf59; CILD26; FBB18; Kur
Locus ID 56683
UniProt ID P57076
Cytogenetics 21q22.11
Summary This gene encodes a protein that plays a critical role in dynein arm assembly and motile cilia function. Mutations in this gene result in primary ciliary dyskinesia. Naturally occuring readthrough transcription occurs from this locus to the downstream t-complex 10 like (TCP10L) gene. [provided by RefSeq, Apr 2017]
Write Your Own Review
You're reviewing:CFAP298 (NM_021254) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402864 C21orf59 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402864 Transient overexpression lysate of chromosome 21 open reading frame 59 (C21orf59) 100 ug
$436.00
TP300169 Recombinant protein of human chromosome 21 open reading frame 59 (C21orf59), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.