WDR5 (NM_052821) Human Mass Spec Standard

SKU
PH300162
WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_438172)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200162]
Predicted MW 36.6 kDa
Protein Sequence
Protein Sequence
>RC200162 protein sequence
Red=Cloning site Green=Tags(s)

MATEEKKPETEAARAQPTPSSSATQSKPTPVKPNYALKFTLAGHTKAVSSVKFSPNGEWLASSSADKLIK
IWGAYDGKFEKTISGHKLGISDVAWSSDSNLLVSASDDKTLKIWDVSSGKCLKTLKGHSNYVFCCNFNPQ
SNLIVSGSFDESVRIWDVKTGKCLKTLPAHSDPVSAVHFNRDGSLIVSSSYDGLCRIWDTASGQCLKTLI
DDDNPPVSFVKFSPNGKYILAATLDNTLKLWDYSKGKCLKTYTGHKNEKYCIFANFSVTGGKWIVSGSED
NLVYIWNLQTKEIVQKLQGHTDVVISTACHPTENIIASAALENDKTIKLWKSDC

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_438172
RefSeq Size 3078
RefSeq ORF 1002
Synonyms BIG-3; CFAP89; SWD3
Locus ID 11091
UniProt ID P61964
Cytogenetics 9q34.2
Summary This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. This protein contains 7 WD repeats. Alternatively spliced transcript variants encoding the same protein have been identified. [provided by RefSeq, Jul 2008]
Protein Families Druggable Genome
Write Your Own Review
You're reviewing:WDR5 (NM_052821) Human Mass Spec Standard
Your Rating
SKU Description Size Price
PH316218 WDR5 MS Standard C13 and N15-labeled recombinant protein (NP_060058) 10 ug
$3,255.00
LC402599 WDR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC409441 WDR5 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402599 Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 1 100 ug
$436.00
LY409441 Transient overexpression lysate of WD repeat domain 5 (WDR5), transcript variant 2 100 ug
$436.00
TP300162 Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 2, 20 µg 20 ug
$737.00
TP316218 Recombinant protein of human WD repeat domain 5 (WDR5), transcript variant 1, 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.