RBM23 (NM_018107) Human Mass Spec Standard

SKU
PH300138
RBM23 MS Standard C13 and N15-labeled recombinant protein (NP_060577)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200138]
Predicted MW 46.8 kDa
Protein Sequence
Protein Sequence
>RC200138 protein sequence
Red=Cloning site Green=Tags(s)

MASDDFDIVIEAMLEAPYKKEEDEQQRKEVKKDYPSNTTSSTSNSGNETSGSSTIGETSNRSRDRDRYRR
RNSRSRSPGRQCRHRSRSWDRRHGSESRSRDHRREDRVHYRSPPLATGYRYGHSKSPHFREKSPVREPVD
NLSPEERDARTVFCMQLAARIRPRDLEDFFSAVGKVRDVRIISDRNSRRSKGIAYVEFCEIQSVPLAIGL
TGQRLLGVPIIVQASQAEKNRLAAMANNLQKGNGGPMRLYVGSLHFNITEDMLRGIFEPFGKIDNIVLMK
DSDTGRSKGYGFITFSDSECARRALEQLNGFELAGRPMRVGHVTERLDGGTDITFPDGDQELDLGSAGGR
FQLMAKLAEGAGIQLPSTAAAAAAAAAAQAAALQLNGAVPLGALNPAALTALSPALNLASQCFQLSSLFT
PQTM

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060577
RefSeq Size 2576
RefSeq ORF 1272
Synonyms CAPERbeta; PP239; RNPC4
Locus ID 55147
UniProt ID Q86U06
Cytogenetics 14q11.2
Summary This gene encodes a member of the U2AF-like family of RNA binding proteins. This protein interacts with some steroid nuclear receptors, localizes to the promoter of a steroid- responsive gene, and increases transcription of steroid-responsive transcriptional reporters in a hormone-dependent manner. It is also implicated in the steroid receptor-dependent regulation of alternative splicing. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]
Write Your Own Review
You're reviewing:RBM23 (NM_018107) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413294 RBM23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC421400 RBM23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LC421401 RBM23 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413294 Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 2 100 ug
$436.00
LY421400 Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 1 100 ug
$665.00
LY421401 Transient overexpression lysate of RNA binding motif protein 23 (RBM23), transcript variant 3 100 ug
$436.00
TP300138 Recombinant protein of human RNA binding motif protein 23 (RBM23), transcript variant 2, 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.