CNDP2 (NM_018235) Human Mass Spec Standard

SKU
PH300120
CNDP2 MS Standard C13 and N15-labeled recombinant protein (NP_060705)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200120]
Predicted MW 52.9 kDa
Protein Sequence
Protein Sequence
>RC200120 protein sequence
Red=Cloning site Green=Tags(s)

MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWPEKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP
DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPAALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW
INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDELIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL
RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI
DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLSLHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP
EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPWVSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYNYIEGTKMLAAYLYEVSQLKD

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_060705
RefSeq Size 5089
RefSeq ORF 1425
Synonyms CN2; CPGL; HEL-S-13; HsT2298; PEPA
Locus ID 55748
UniProt ID Q96KP4
Cytogenetics 18q22.3
Summary CNDP2, also known as tissue carnosinase and peptidase A (EC 3.4.13.18), is a nonspecific dipeptidase rather than a selective carnosinase (Teufel et al., 2003 [PubMed 12473676]).[supplied by OMIM, Mar 2008]
Protein Families Protease
Write Your Own Review
You're reviewing:CNDP2 (NM_018235) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC413215 CNDP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LC432984 CNDP2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY413215 Transient overexpression lysate of CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), transcript variant 1 100 ug
$436.00
LY432984 Transient overexpression lysate of CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), transcript variant 2 100 ug
$436.00
TP300120 Recombinant protein of human CNDP dipeptidase 2 (metallopeptidase M20 family) (CNDP2), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.