OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

NARS1 (NM_004539) Human Mass Spec Standard

Be the first to review this product
SKU
PH300087
NARS MS Standard C13 and N15-labeled recombinant protein (NP_004530)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA370392 NARS1 rabbit polyclonal antibody
100 ul
$310.00
LY417931 Transient overexpression lysate of asparaginyl-tRNA synthetase (NARS) (as WB positive control) 100 ug
$436.00

Other products for "NARS1 or NM_004539"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200087
Predicted MW 62.9 kDa
Protein Sequence
Protein Sequence
>RC200087 protein sequence
Red=Cloning site Green=Tags(s)

MVLAELYVSDREGSDATGDGTKEKPFKTGLKALMTVGKEPFPTIYVDSQKENERWNVISKSQLKNIKKMW
HREQMKSESREKKEAEDSLRREKNLEEAKKITIKNDPSLPEPKCVKIGALEGYRGQRVKVFGWVHRLRRQ
GKNLMFLVLRDGTGYLQCVLADELCQCYNGVLLSTESSVAVYGMLNLTPKGKQAPGGHELSCDFWELIGL
APAGGADNLINEESDVDVQLNNRHMMIRGENMSKILKARSMVTRCFRDHFFDRGYYEVTPPTLVQTQVEG
GATLFKLDYFGEEAFLTQSSQLYLETCLPALGDVFCIAQSYRAEQSRTRRHLAEYTHVEAECPFLTFDDL
LNRLEDLVCDVVDRILKSPAGSIVHELNPNFQPPKRPFKRMNYSDAIVWLKEHDVKKEDGTFYEFGEDIP
EAPERLMTDTINEPILLCRFPVEIKSFYMQRCPEDSRLTESVDVLMPNVGEIVGGSMRIFDSEEILAGYK
REGIDPTPYYWYTDQRKYGTCPHGGYGLGLERFLTWILNRYHIRDVCLYPRFVQRCTP

SGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_004530
RefSeq Size 2868
RefSeq ORF 1644
Synonyms ASNRS; NARS
Locus ID 4677
UniProt ID O43776
Cytogenetics 18q21.31
Summary Aminoacyl-tRNA synthetases are a class of enzymes that charge tRNAs with their cognate amino acids. Asparaginyl-tRNA synthetase is localized to the cytoplasm and belongs to the class II family of tRNA synthetases. The N-terminal domain represents the signature sequence for the eukaryotic asparaginyl-tRNA synthetases. provided by RefSeq, Jul 2008
Protein Pathways Aminoacyl-tRNA biosynthesis
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "NARS1" proteins (3)
SKU Description Size Price
LC417931 Lyophilized NARS HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY417931 Transient overexpression lysate of asparaginyl-tRNA synthetase (NARS) (as WB positive control) 100 ug
$436.00
TP300087 Recombinant protein of human asparaginyl-tRNA synthetase (NARS), 20 µg 20 ug
$737.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products