ZAK (MAP3K20) (NM_133646) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200069] |
Predicted MW | 51.6 kDa |
Protein Sequence |
Protein Sequence
>RC200069 protein sequence
Red=Cloning site Green=Tags(s) MSSLGASFVQIKFDDLQFFENCGGGSFGSVYRAKWISQDKEVAVKKLLKIEKEAEILSVLSHRNIIQFYG VILEPPNYGIVTEYASLGSLYDYINSNRSEEMDMDHIMTWATDVAKGMHYLHMEAPVKVIHRDLKSRNVV IAADGVLKICDFGASRFHNHTTHMSLVGTFPWMAPEVIQSLPVSETCDTYSYGVVLWEMLTREVPFKGLE GLQVAWLVVEKNERLTIPSSCPRSFAELLHQCWEADAKKRPSFKQIISILESMSNDTSLPDKCNSFLHNK AEWRCEIEATLERLKKLERDLSFKEQELKERERRLKMWEQKLTEQSNTPLLLPLAARMSEESYFESKTEE SNSAEMSCQITATSNGEGHGMNPSLQAMMLMGFGDIFSMNKAGAVMHSGMQINMQAKQNSSKTTSKRRGK KVNMALGFSDFDLSEGDDDDDDDGEEEDNDMDNSE myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_598407 |
RefSeq Size | 7194 |
RefSeq ORF | 1365 |
Synonyms | AZK; CNM6; MLK7; mlklak; MLT; MLTK; MLTKalpha; MLTKbeta; MRK; pk; SFMMP; ZAK |
Locus ID | 51776 |
UniProt ID | Q9NYL2 |
Cytogenetics | 2q31.1 |
Summary | This gene is a member of the MAPKKK family of signal transduction molecules and encodes a protein with an N-terminal kinase catalytic domain, followed by a leucine zipper motif and a sterile-alpha motif (SAM). This magnesium-binding protein forms homodimers and is located in the cytoplasm. The protein mediates gamma radiation signaling leading to cell cycle arrest and activity of this protein plays a role in cell cycle checkpoint regulation in cells. The protein also has pro-apoptotic activity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008] |
Protein Families | Druggable Genome, Protein Kinase |
Protein Pathways | MAPK signaling pathway, Tight junction |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
PH321970 | ZAK MS Standard C13 and N15-labeled recombinant protein (NP_057737) | 10 ug |
$3,255.00
|
|
LC408752 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LC413852 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LC429511 | ZAK HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$206.00
|
|
LY408752 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2 | 100 ug |
$436.00
|
|
LY413852 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 | 100 ug |
$665.00
|
|
LY429511 | Transient overexpression lysate of sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1 | 100 ug |
$665.00
|
|
TP300069 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 2, 20 µg | 20 ug |
$867.00
|
|
TP321970 | Recombinant protein of human sterile alpha motif and leucine zipper containing kinase AZK (ZAK), transcript variant 1, 20 µg | 20 ug |
$867.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.