IMPA2 (NM_014214) Human Mass Spec Standard
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
- Bulk quantity
- Different host
- Tags
- Mutations
- Buffers
- SEC testing
- Concentration
Product Data | |
Tag | C-Myc/DDK |
---|---|
Species | Human |
Expression Host | HEK293 |
Expression cDNA Clone or AA Sequence | [RC200063] |
Predicted MW | 31.3 kDa |
Protein Sequence |
Protein Sequence
>RC200063 protein sequence
Red=Cloning site Green=Tags(s) MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI NYGRDDEK myc-FLAG tag |
Purity | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Concentration | >0.05 µg/µL as determined by microplate BCA method |
Labeling Method | Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine |
Buffer | 25 mM Tris-HCl, 100 mM glycine, pH 7.3 |
Storage | Store at -80°C. Avoid repeated freeze-thaw cycles. |
Stability | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Shipping | Dry Ice |
Reference Data | |
RefSeq | NP_055029 |
RefSeq Size | 1537 |
RefSeq ORF | 864 |
Locus ID | 3613 |
UniProt ID | O14732 |
Cytogenetics | 18p11.21 |
Summary | This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011] |
Protein Pathways | Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system |
Write Your Own Review
FAQs |
SDS |
Recombinant Protein Resources |
SKU | Description | Size | Price | |
---|---|---|---|---|
LC415429 | IMPA2 HEK293T cell transient overexpression lysate (as WB positive control) | 20 ug |
$134.00
|
|
LY415429 | Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) | 100 ug |
$436.00
|
|
TP300063 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2), 20 µg | 20 ug |
$564.00
MSRP
$867.00
MSRP
$867.00
|
|
TP720526 | Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) | 10 ug |
$330.00
|
|
Citations
*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen
complexities in the preparation of your product. International customers may expect an additional 1-2 weeks
in shipping.