IMPA2 (NM_014214) Human Mass Spec Standard

SKU
PH300063
IMPA2 MS Standard C13 and N15-labeled recombinant protein (NP_055029)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200063]
Predicted MW 31.3 kDa
Protein Sequence
Protein Sequence
>RC200063 protein sequence
Red=Cloning site Green=Tags(s)

MKPSGEDQAALAAGPWEECFQAAVQLALRAGQIIRKALTEEKRVSTKTSAADLVTETDHLVEDLIISELR
ERFPSHRFIAEEAAASGAKCVLTHSPTWIIDPIDGTCNFVHRFPTVAVSIGFAVRQELEFGVIYHCTEER
LYTGRRGRGAFCNGQRLRVSGETDLSKALVLTEIGPKRDPATLKLFLSNMERLLHAKAHGVRVIGSSTLA
LCHLASGAADAYYQFGLHCWDLAAATVIIREAGGIVIDTSGGPLDLMACRVVAASTREMAMLIAQALQTI
NYGRDDEK

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055029
RefSeq Size 1537
RefSeq ORF 864
Locus ID 3613
UniProt ID O14732
Cytogenetics 18p11.21
Summary This locus encodes an inositol monophosphatase. The encoded protein catalyzes the dephosphoylration of inositol monophosphate and plays an important role in phosphatidylinositol signaling. This locus may be associated with susceptibility to bipolar disorder. [provided by RefSeq, Jan 2011]
Protein Pathways Inositol phosphate metabolism, Metabolic pathways, Phosphatidylinositol signaling system
Write Your Own Review
You're reviewing:IMPA2 (NM_014214) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC415429 IMPA2 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY415429 Transient overexpression lysate of inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) 100 ug
$436.00
TP300063 Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00
TP720526 Recombinant protein of human inositol(myo)-1(or 4)-monophosphatase 2 (IMPA2) 10 ug
$330.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.