PPP2R1A (NM_014225) Human Mass Spec Standard

SKU
PH300056
PPP2R1A MS Standard C13 and N15-labeled recombinant protein (NP_055040)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200056]
Predicted MW 65.3 kDa
Protein Sequence
Protein Sequence
>RC200056 protein sequence
Red=Cloning site Green=Tags(s)

MAAADGDDSLYPIAVLIDELRNEDVQLRLNSIKKLSTIALALGVERTRSELLPFLTDTIYDEDEVLLALA
EQLGTFTTLVGGPEYVHCLLPPLESLATVEETVVRDKAVESLRAISHEHSPSDLEAHFVPLVKRLAGGDW
FTSRTSACGLFSVCYPRVSSAVKAELRQYFRNLCSDDTPMVRRAAASKLGEFAKVLELDNVKSEIIPMFS
NLASDEQDSVRLLAVEACVNIAQLLPQEDLEALVMPTLRQAAEDKSWRVRYMVADKFTELQKAVGPEITK
TDLVPAFQNLMKDCEAEVRAAASHKVKEFCENLSADCRENVIMSQILPCIKELVSDANQHVKSALASVIM
GLSPILGKDNTIEHLLPLFLAQLKDECPEVRLNIISNLDCVNEVIGIRQLSQSLLPAIVELAEDAKWRVR
LAIIEYMPLLAGQLGVEFFDEKLNSLCMAWLVDHVYAIREAATSNLKKLVEKFGKEWAHATIIPKVLAMS
GDPNYLHRMTTLFCINVLSEVCGQDITTKHMLPTVLRMAGDPVANVRFNVAKSLQKIGPILDNSTLQSEV
KPILEKLTQDQDVDVKYFAQEALTVLSLA

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_055040
RefSeq Size 2519
RefSeq ORF 1767
Synonyms MRD36; PP2A-Aalpha; PP2AA; PP2AAALPHA; PR65A
Locus ID 5518
UniProt ID P30153
Cytogenetics 19q13.41
Summary This gene encodes a constant regulatory subunit of protein phosphatase 2. Protein phosphatase 2 is one of the four major Ser/Thr phosphatases, and it is implicated in the negative control of cell growth and division. It consists of a common heteromeric core enzyme, which is composed of a catalytic subunit and a constant regulatory subunit, that associates with a variety of regulatory subunits. The constant regulatory subunit A serves as a scaffolding molecule to coordinate the assembly of the catalytic subunit and a variable regulatory B subunit. This gene encodes an alpha isoform of the constant regulatory subunit A. Alternatively spliced transcript variants have been described. [provided by RefSeq, Apr 2010]
Protein Families Druggable Genome, Phosphatase, Transcription Factors
Protein Pathways Long-term depression, Oocyte meiosis, TGF-beta signaling pathway, Tight junction, Wnt signaling pathway
Write Your Own Review
You're reviewing:PPP2R1A (NM_014225) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC402290 PPP2R1A HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY402290 Transient overexpression lysate of protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A) 100 ug
$436.00
TP300056 Recombinant protein of human protein phosphatase 2 (formerly 2A), regulatory subunit A, alpha isoform (PPP2R1A), 20 µg 20 ug
$737.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.