HEMK1 (NM_016173) Human Mass Spec Standard

SKU
PH300039
HEMK1 MS Standard C13 and N15-labeled recombinant protein (NP_057257)
$3,255.00
3 Weeks*
Need Bulk or Customize
Customization Options:
  • Bulk quantity
  • Different host
  • Tags
  • Mutations
  • Buffers
  • SEC testing
  • Concentration
Proudly made in the USA
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence [RC200039]
Predicted MW 38.2 kDa
Protein Sequence
Protein Sequence
>RC200039 protein sequence
Red=Cloning site Green=Tags(s)

MELWGRMLWALLSGPGRRGSTRGWAFSSWQPQPPLAGLSSAIELVSHWTGVFEKRGIPEARESSEYIVAH
VLGAKTFQSLRPALWTQPLTSQQLQCIRELSSRRLQRMPVQYILGEWDFQGLSLRMVPPVFIPRPETEEL
VEWVLEEVAQRSHAVGSPGSPLILEVGCGSGAISLSLLSQLPQSRVIAVDKREAAISLTHENAQRLRLQD
RIWIIHLDMTSERSWTHLPWGPMDLIVSNPPYVFHQDMEQLAPEIRSYEDPAALDGGEEGMDIITHILAL
APRLLKDSGSIFLEVDPRHPELVSSWLQSRPDLYLNLVAVRRDFCGRPRFLHIRRSGP

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with [U- 13C6, 15N4]-L-Arginine and [U- 13C6, 15N2]-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_057257
RefSeq Size 5862
RefSeq ORF 1014
Synonyms HEMK; MPRMC; MTQ1
Locus ID 51409
UniProt ID Q9Y5R4
Cytogenetics 3p21.31
Summary N5-glutamine methyltransferase responsible for the methylation of the glutamine residue in the universally conserved GGQ motif of the mitochondrial translation release factor MTRF1L.[UniProtKB/Swiss-Prot Function]
Protein Families Druggable Genome
Protein Pathways Androgen and estrogen metabolism, Histidine metabolism, Selenoamino acid metabolism, Tyrosine metabolism
Write Your Own Review
You're reviewing:HEMK1 (NM_016173) Human Mass Spec Standard
Your Rating
SKU Description Size Price
LC414143 HEMK1 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$134.00
LY414143 Transient overexpression lysate of HemK methyltransferase family member 1 (HEMK1) 100 ug
$436.00
TP300039 Recombinant protein of human HemK methyltransferase family member 1 (HEMK1), 20 µg 20 ug
$564.00 MSRP $867.00 MSRP $867.00

Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.