OriGene Logo

Customer Login

Checkout as a new customer

Creating an account has many benefits:

  • See order and shipping status
  • Track order history
  • Check out faster
Create an Account

GAL4 (LGALS4) (NM_006149) Human Mass Spec Standard

Be the first to review this product
SKU
PH300026
LGALS4 MS Standard C13 and N15-labeled recombinant protein (NP_006140)
Size:
10 ug
  $3,360.00
3 Weeks*
Bulk/Customize

Frequently Bought Together (2)

TA368351 LGALS4 rabbit polyclonal antibody
100 ul
$310.00
LY416836 Transient overexpression lysate of lectin, galactoside-binding, soluble, 4 (LGALS4) (as WB positive control) 100 ug
$436.00

Other products for "GAL4 or NM_006149"

Specifications
Specifications
Product Data
Tag C-Myc/DDK
Species Human
Expression Host HEK293
Expression cDNA Clone or AA Sequence RC200026
Predicted MW 35.8 kDa
Protein Sequence
Protein Sequence
>RC200026 representing NM_006149
Red=Cloning site Green=Tags(s)

MAYVPAPGYQPTYNPTLPYYQPIPGGLNVGMSVYIQGVASEHMKRFFVNFVVGQDPGSDVAFHFNPRFDG
WDKVVFNTLQGGKWGSEERKRSMPFKKGAAFELVFIVLAEHYKVVVNGNPFYEYGHRLPLQMVTHLQVDG
DLQLQSINFIGGQPLRPQGPPMMPPYPGPGHCHQQLNSLPTMEGPPTFNPPVPYFGRLQGGLTARRTIII
KGYVPPTGKSFAINFKVGSSGDIALHINPRMGNGTVVRNSLLNGSWGSEEKKITHNPFGPGQFFDLSIRC
GLDRFKVYANGQHLFDFAHRLSAFQRVDTLEIQGDVTLSYVQI

myc-FLAG tag
Purity > 80% as determined by SDS-PAGE and Coomassie blue staining
Concentration >0.05 µg/µL as determined by microplate BCA method
Labeling Method Labeled with U- 13C6, 15N4-L-Arginine and U- 13C6, 15N2-L-Lysine
Buffer 25 mM Tris-HCl, 100 mM glycine, pH 7.3
Storage Store at -80°C. Avoid repeated freeze-thaw cycles.
Stability Stable for 3 months from receipt of products under proper storage and handling conditions.
Shipping Dry Ice
Reference Data
RefSeq NP_006140
RefSeq Size 1117
RefSeq ORF 969
Synonyms GAL4; L36LBP
Locus ID 3960
UniProt ID P56470
Cytogenetics 19q13.2
Summary The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. The expression of this gene is restricted to small intestine, colon, and rectum, and it is underexpressed in colorectal cancer. provided by RefSeq, Jul 2008
Reviews
Write Review
 
 
 
 
 

Be the first to review this product

Please note:
Only reviews with images are eligible for a $20/20€ Amazon gift card.
Reviews without images are eligible for a $10/10€ Amazon gift card.
For more details about the terms and conditions, please visit the promotion page.

Review image
Documents
Resources
Other "GAL4" proteins (3)
SKU Description Size Price
LC416836 Lyophilized LGALS4 HEK293T cell transient overexpression lysate (as WB positive control) 20 ug
$206.00
LY416836 Transient overexpression lysate of lectin, galactoside-binding, soluble, 4 (LGALS4) (as WB positive control) 100 ug
$436.00
TP300026 Recombinant protein of human lectin, galactoside-binding, soluble, 4 (LGALS4), 20 µg 20 ug
$867.00

file-alt Citations

*Delivery time may vary from web posted schedule. Occasional delays may occur due to unforeseen complexities in the preparation of your product. International customers may expect an additional 1-2 weeks in shipping.

Related Products